KEGG   Homo sapiens (human): 3316Help
Entry
3316              CDS       T01001                                 

Gene name
HSPB2, HSP27, Hs.78846, LOH11CR1K, MKBP
Definition
(RefSeq) heat shock protein family B (small) member 2
  KO
K09543  heat shock protein beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3316 (HSPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3316 (HSPB2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   3316 (HSPB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20 Crystallin
Motif
Other DBs
NCBI-GeneID: 3316
NCBI-ProteinID: NP_001532
OMIM: 602179
HGNC: 5247
Ensembl: ENSG00000170276
Vega: OTTHUMG00000166886
Pharos: Q16082(Tbio)
UniProt: Q16082 A8KAH6
Structure
PDB: 

Position
11q23.1
AA seq 182 aa AA seqDB search
MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGS
RAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRT
YVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIV
EP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccgctcagtgccacatgcccacccggccaccgccgagtacgaatttgccaac
ccgagccgcctgggtgagcagcgcttcggagaaggcctcctgccagaagagatcctgacc
cccacactctaccatggctactatgtccggcctcgggccgccccagctggggagggcagc
agggcaggggcctccgagcttaggctcagtgagggcaagttccaggcatttctggatgtg
agccactttaccccagacgaggtgactgtgaggactgtggataacctgctggaggtgtct
gcccggcacccccagcgcctggaccgccacggcttcgtgtcccgagagttctgccgcacc
tatgtcctgcctgctgatgtcgacccctggcgagtccgagctgctctctcccatgatggc
atcttaaacctggaagcacctcggggtggccgacatttggacacagaggtcaatgaggtc
tacatctccctgctccctgcgcctcctgatccagaggaagaggaggaggcagccatagtt
gagccctga

DBGET integrated database retrieval system