KEGG   Homo sapiens (human): 332Help
Entry
332               CDS       T01001                                 

Gene name
BIRC5, API4, EPR-1
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04390  Hippo signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06271  Endometrial cancer
  Element
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00533  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
Drug target
Gataparsen (DG01431): D09909 D09910
Sepantronium bromide: D10164
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    332 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    332 (BIRC5)
   04215 Apoptosis - multiple species
    332 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    332 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    332 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    332 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    332 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    332 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    332 (BIRC5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   332 (BIRC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     332 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    332 (BIRC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR
Motif
Other DBs
NCBI-GeneID: 332
NCBI-ProteinID: NP_001159
OMIM: 603352
HGNC: 593
Ensembl: ENSG00000089685
Vega: OTTHUMG00000177505
Pharos: O15392(Tchem)
UniProt: O15392 A0A0B4J1S3
Structure
PDB: 

Position
17q25.3
AA seq 142 aa AA seqDB search
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtccggttgcgctttcctttctgtcaagaagcagtttgaagaattaacccttggtgaa
tttttgaaactggacagagaaagagccaagaacaaaattgcaaaggaaaccaacaataag
aagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctgcc
atggattga

DBGET integrated database retrieval system