KEGG   Homo sapiens (human): 3321Help
Entry
3321              CDS       T01001                                 

Gene name
IGSF3, EWI-3, LCDD, V8
Definition
(RefSeq) immunoglobulin superfamily member 3
  KO
K06522  immunoglobulin superfamily, member 2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3321 (IGSF3)
   04090 CD molecules [BR:hsa04090]
    3321 (IGSF3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3321 (IGSF3)
CD molecules [BR:hsa04090]
 Proteins
  3321 (IGSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 LAT Ribosomal_60s CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 3321
NCBI-ProteinID: NP_001007238
OMIM: 603491
HGNC: 5950
Ensembl: ENSG00000143061
Vega: OTTHUMG00000022751
Pharos: O75054(Tbio)
UniProt: O75054
Position
1p13.1
AA seq 1194 aa AA seqDB search
MKCFFPVLSCLAVLGVVSAQRQVTVQEGPLYRTEGSHITIWCNVSGYQGPSEQNFQWSIY
LPSSPEREVQIVSTMDSSFPYAIYTQRVRGGKIFIERVQGNSTLLHITDLQARDAGEYEC
HTPSTDKQYFGSYSAKMNLVVIPDSLQTTAMPQTLHRVEQDPLELTCEVASETIQHSHLS
VAWLRQKVGEKPVEVISLSRDFMLHSSSEYAQRQSLGEVRLDKLGRTTFRLTIFHLQPSD
QGEFYCEAAEWIQDPDGSWYAMTRKRSEGAVVNVQPTDKEFTVRLETEKRLHTVGEPVEF
RCILEAQNVPDRYFAVSWAFNSSLIATMGPNAVPVLNSEFAHREARGQLKVAKESDSVFV
LKIYHLRQEDSGKYNCRVTEREKTVTGEFIDKESKRPKNIPIIVLPLKSSISVEVASNAS
VILEGEDLRFSCSVRTAGRPQGRFSVIWQLVDRQNRRSNIMWLDRDGTVQPGSSYWERSS
FGGVQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRAVDGEWQIVGERRASTPISITA
LEMGFAVTAISRTPGVTYSDSFDLQCIIKPHYPAWVPVSVTWRFQPVGTVEFHDLVTFTR
DGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRKNYNNTWTR
LAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCSVKSQTSQNSHFAVLWYVH
KPSDADGKLILKTTHNSAFEYGTYAEEEGLRARLQFERHVSGGLFSLTVQRAEVSDSGSY
YCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQAQGNLSVLETRQVQLECVV
LNRTSITSQLMVEWFVWKPNHPERETVARLSRDATFHYGEQAAKNNLKGRLHLESPSPGV
YRLFIQNVAVQDSGTYSCHVEEWLPSPSGMWYKRAEDTAGQTALTVMRPDASLQVDTVVP
NATVSEKAAFQLDCSIVSRSSQDSRFAVAWYSLRTKAGGKRSSPGLEEQEEEREEEEEED
DDDDDDPTERTALLSVGPDAVFGPEGSPWEGRLRFQRLSPVLYRLTVLQASPQDTGNYSC
HVEEWLPSPQKEWYRLTEEESAPIGIRVLDTSPTLQSIICSNDALFYFVFFYPFPIFGIL
IITILLVRFKSRNSSKNSDGKNGVPLLWIKEPHLNYSPTCLEPPVLSIHPGAID
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgctttttcccggtgctgagctgtctggctgtgctgggtgtggtgtcagcacag
cggcaggtcaccgttcaggaaggacccttgtaccgcacggagggctcccacatcactatc
tggtgcaatgtgagtggctaccagggaccttctgagcagaatttccagtggtccatttac
ctgccttcgtcgccagagcgagaggtgcagatcgtcagcaccatggactcttccttcccc
tatgccatctacacccagcgcgtccgcggagggaagatcttcatagaaagagtccagggg
aactcaaccctattgcacatcacagatcttcaggcccgggatgccggggagtatgaatgc
cacacacccagcactgataagcaatactttgggagttacagtgcaaagatgaacctagtg
gtgatcccagactccctgcagaccactgccatgccccagactctgcacagagtggagcag
gacccgctggagctcacttgtgaggtggcctcagagaccattcagcacagccacctgtct
gtggcctggctccggcagaaagttggcgagaagcccgtggaggtcatctccctgagccga
gatttcatgcttcactccagcagcgaatatgcccagaggcagagcctgggggaggtgcgg
ctggacaagctggggaggaccaccttccgcctcaccatcttccacctgcagccttctgac
cagggcgaattctactgcgaggccgccgagtggatccaggatccggatgggtcgtggtat
gctatgacccgaaagcgttccgagggagccgtggtcaacgtccagccaactgacaaagaa
ttcactgttcggctggagacagagaagcggctgcacacggtgggcgagccggtggagttc
agatgcatcctggaggctcagaatgttcccgaccgttactttgctgtctcctgggccttc
aacagctcgctcatcgccaccatgggtcctaacgctgtgcctgtcctcaacagcgaattt
gctcaccgggaagccaggggacagcttaaggtggccaaagagagcgacagtgtctttgtg
ctgaagatctaccacctccgccaggaagatagcgggaaatacaactgccgggtgactgag
cgagagaaaaccgtgaccggggaattcattgataaggagagcaagcgtcccaagaacatc
cccatcatagtcctccccctcaagagcagcatctccgtggaggtggccagcaatgccagc
gtcatccttgagggcgaggacctgcgcttctcctgcagtgtccgcacggcaggcaggccg
cagggtcgcttctctgtcatctggcagcttgtggacaggcagaaccgccgcagcaatatc
atgtggctagaccgggatggcaccgtgcagccaggctcgtcctactgggagcgcagcagc
tttgggggcgtccagatggagcaggtgcagcccaactcgttcagcctgggcatcttcaac
agcaggaaggaggacgagggccagtatgaatgccatgtgactgaatgggtgcgggcagtg
gatggcgagtggcagattgttggggagcgccgggccagcactcccatctccatcacagct
cttgaaatgggcttcgcagtcacagccatctcccggacaccgggggtgacctacagcgac
tcctttgacttgcagtgtatcatcaaaccccactaccctgcctgggtccccgtgtcggtg
acatggcggttccagccggtgggcacggtggagttccatgacttggtgaccttcacccgg
gacggaggggtccagtggggggacaggtcctccagcttccgaacccgaactgccatcgag
aaggctgagtccagcaacaacgtccgcctaagcatcagccgagccagtgacacggaagca
ggcaagtaccagtgtgtggcagagctgtggcggaagaactacaacaacacctggacgcga
ctggcggagaggacctccaacctgctggagatcagggtgctgcagccagtgacaaagctg
caggtgagcaaatcgaagaggaccctcaccctggtggaaaacaagcccattcagttgaac
tgctcagtcaagtctcagactagccagaactcccactttgcggtgctctggtatgtccac
aagccctcggatgccgatggcaagcttatcctgaagaccacccacaactccgcctttgaa
tacggtacttacgccgaggaggagggcctgagagccaggctccagtttgagaggcatgtg
tcggggggcctgttcagcctcaccgtccagagagccgaggtcagcgacagcggcagctac
tactgccacgtggaggagtggctgctgagccccaactacgcctggtacaagctggcagag
gaggtttctgggcgcacagaagtcactgtgaaacagccagacagccgcctgaggctcagc
caagcccaggggaacctgtcggttctggagacccggcaggtacagctggagtgtgtggtt
ctcaaccgcaccagcataacctcccagctcatggtggaatggtttgtatggaagcccaac
caccctgagcgggagactgtggcccgcttgagccgtgacgccaccttccactatggagag
caggcagccaagaacaatctgaaggggcggctgcatttggagagtccttcccccggcgtg
taccgtctcttcatccagaacgtggctgtgcaggacagcgggacctacagctgccatgtg
gaggagtggctgcccagccccagtggcatgtggtataagcgggcagaggacaccgctggg
cagacagctctgacagtcatgcgaccagatgcttccctgcaggtggacacagtggtcccc
aatgccacggtctctgagaaggcagctttccagctggactgtagcatcgtgtcccgctcc
agccaggactcccgcttcgctgtggcctggtattccctgaggactaaagctggggggaaa
aggagcagccctggcctggaagaacaggaagaggaaagggaggaggaggaggaggaggac
gacgacgacgacgacgacccaacagagcggacggccctgctgagcgtgggcccagatgct
gtctttggcccagagggcagtccttgggagggcaggcttcgcttccagaggctctccccg
gtgctctaccggctcacagtgctgcaggcaagcccccaagatacaggcaattactcctgc
catgtggaggagtggctgcccagccctcagaaggaatggtaccggctgacggaggaggag
tcagcccccatcggcatccgtgttctagatacaagtcccaccctccagtccatcatctgc
tccaacgacgcactcttctacttcgtcttcttctaccctttccccatctttggcattctt
atcatcaccatccttctggtgcgtttcaagagccggaactccagcaagaactctgatggg
aagaatggggtgcctctgctgtggatcaaagagccacacctcaactactcccctacttgc
ctggagccccctgttctcagtatccatccaggggccatagactaa

DBGET integrated database retrieval system