KEGG   Homo sapiens (human): 3326Help
Entry
3326              CDS       T01001                                 

Gene name
HSP90AB1, D6S182, HSP84, HSP90B, HSPC2, HSPCB
Definition
(RefSeq) heat shock protein 90 alpha family class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04612  Antigen processing and presentation
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Ganetespib: D10126
Luminespib (DG01842): D10646 D10647
Onalespib: D10719
Retaspimycin (DG01880): D09375 D09376
Tanespimycin: D06650
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3326 (HSP90AB1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3326 (HSP90AB1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3326 (HSP90AB1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    3326 (HSP90AB1)
   04612 Antigen processing and presentation
    3326 (HSP90AB1)
   04659 Th17 cell differentiation
    3326 (HSP90AB1)
   04657 IL-17 signaling pathway
    3326 (HSP90AB1)
  Endocrine system
   04915 Estrogen signaling pathway
    3326 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    3326 (HSP90AB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3326 (HSP90AB1)
   05215 Prostate cancer
    3326 (HSP90AB1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3326 (HSP90AB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3326 (HSP90AB1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   3326 (HSP90AB1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3326 (HSP90AB1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3326 (HSP90AB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    3326 (HSP90AB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3326 (HSP90AB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF1198
Motif
Other DBs
NCBI-GeneID: 3326
NCBI-ProteinID: NP_001258898
OMIM: 140572
HGNC: 5258
Ensembl: ENSG00000096384
Vega: OTTHUMG00000014761
Pharos: P08238(Tchem)
UniProt: P08238 A0A024RD80
Structure
PDB: 

Position
6p21.1
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtccctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcctgaca
gacccttcgaagttggacagtggtaaagagctgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattggcatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgattgggcagtttggtgttggcttttattctgcctacttggtggca
gagaaagtggttgtgatcacaaagcacaacgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgtgctgaccatggtgagcccattggcaggggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacctagaagagaggcgggtcaaagaa
gtagtgaagaagcattctcagttcataggctatcccatcaccctttatttggagaaggaa
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaaacccaagatcgaagatgtgggttcagatgaggaggatgac
agcggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gaactaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctacaagagcctcactaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaattcagggcattgctatttattcctcgtcgggctccc
tttgacctttttgagaacaagaagaaaaagaacaacatcaaactctatgtccgccgtgtg
ttcatcatggacagctgtgatgagttgataccagagtatctcaattttatccgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgcaaaaacattgttaagaagtgccttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccacgaagactccactaaccgccgccgcctgtctgagctgctgcgctatcatacctcc
cagtctggagatgagatgacatctctgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgacgagtac
tgtgtgcagcagctcaaggaatttgatgggaagagcctggtctcagttaccaaggagggt
ctggagctgcctgaggatgaggaggagaagaagaagatggaagagagcaaggcaaagttt
gagaacctctgcaagctcatgaaagaaatcttagataagaaggttgagaaggtgacaatc
tccaatagacttgtgtcttcaccttgctgcattgtgaccagcacctacggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccaccatgggctatatg
atggccaaaaagcacctggagatcaaccctgaccaccccattgtggagacgctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctatcttctggcttttcccttgaggatccccagacccactccaaccgcatc
tatcgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaggaaccc
aatgctgcagttcctgatgagatcccccctctcgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

DBGET integrated database retrieval system