KEGG   Homo sapiens (human): 3326Help
Entry
3326              CDS       T01001                                 

Gene name
HSP90AB1, D6S182, HSP84, HSP90B, HSPC2, HSPCB
Definition
(RefSeq) heat shock protein 90 alpha family class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04612  Antigen processing and presentation
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Alvespimycin hydrochloride: D06554
Ganetespib: D10126
Luminespib (DG01842): D10646 D10647
Onalespib: D10719
Retaspimycin (DG01880): D09375 D09376
Tanespimycin: D06650
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3326 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3326 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3326 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    3326 (HSP90AB1)
   04612 Antigen processing and presentation
    3326 (HSP90AB1)
   04659 Th17 cell differentiation
    3326 (HSP90AB1)
   04657 IL-17 signaling pathway
    3326 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3326 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    3326 (HSP90AB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3326 (HSP90AB1)
  09162 Cancers: Specific types
   05215 Prostate cancer
    3326 (HSP90AB1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3326 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3326 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3326 (HSP90AB1)
   04131 Membrane trafficking [BR:hsa04131]
    3326 (HSP90AB1)
   03051 Proteasome [BR:hsa03051]
    3326 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3326 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3326 (HSP90AB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3326 (HSP90AB1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   3326 (HSP90AB1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3326 (HSP90AB1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3326 (HSP90AB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    3326 (HSP90AB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3326 (HSP90AB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 3326
NCBI-ProteinID: NP_001258898
OMIM: 140572
HGNC: 5258
Ensembl: ENSG00000096384
Vega: OTTHUMG00000014761
Pharos: P08238(Tchem)
UniProt: P08238 A0A024RD80
Structure
PDB: 

Position
6p21.1
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtccctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcctgaca
gacccttcgaagttggacagtggtaaagagctgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattggcatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgattgggcagtttggtgttggcttttattctgcctacttggtggca
gagaaagtggttgtgatcacaaagcacaacgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgtgctgaccatggtgagcccattggcaggggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacctagaagagaggcgggtcaaagaa
gtagtgaagaagcattctcagttcataggctatcccatcaccctttatttggagaaggaa
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaaacccaagatcgaagatgtgggttcagatgaggaggatgac
agcggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gaactaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctacaagagcctcactaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaattcagggcattgctatttattcctcgtcgggctccc
tttgacctttttgagaacaagaagaaaaagaacaacatcaaactctatgtccgccgtgtg
ttcatcatggacagctgtgatgagttgataccagagtatctcaattttatccgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgcaaaaacattgttaagaagtgccttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccacgaagactccactaaccgccgccgcctgtctgagctgctgcgctatcatacctcc
cagtctggagatgagatgacatctctgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgacgagtac
tgtgtgcagcagctcaaggaatttgatgggaagagcctggtctcagttaccaaggagggt
ctggagctgcctgaggatgaggaggagaagaagaagatggaagagagcaaggcaaagttt
gagaacctctgcaagctcatgaaagaaatcttagataagaaggttgagaaggtgacaatc
tccaatagacttgtgtcttcaccttgctgcattgtgaccagcacctacggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccaccatgggctatatg
atggccaaaaagcacctggagatcaaccctgaccaccccattgtggagacgctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctatcttctggcttttcccttgaggatccccagacccactccaaccgcatc
tatcgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaggaaccc
aatgctgcagttcctgatgagatcccccctctcgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

DBGET integrated database retrieval system