KEGG   Homo sapiens (human): 3329Help
Entry
3329              CDS       T01001                                 

Gene name
HSPD1, CPN60, GROEL, HLD4, HSP-60, HSP60, HSP65, HuCHA60, SPG13
Definition
(RefSeq) heat shock protein family D (Hsp60) member 1
  KO
K04077  chaperonin GroEL
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa04940  Type I diabetes mellitus
hsa05134  Legionellosis
hsa05152  Tuberculosis
Disease
H00266  Hereditary spastic paraplegia (SPG)
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    3329 (HSPD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3329 (HSPD1)
  09167 Infectious diseases
   05134 Legionellosis
    3329 (HSPD1)
   05152 Tuberculosis
    3329 (HSPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    3329 (HSPD1)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3329 (HSPD1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3329 (HSPD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3329 (HSPD1)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     3329 (HSPD1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   3329 (HSPD1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    3329 (HSPD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3329 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   3329 (HSPD1)
  Exosomal proteins of breast cancer cells
   3329 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   3329 (HSPD1)
  Exosomal proteins of bladder cancer cells
   3329 (HSPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 3329
NCBI-ProteinID: NP_002147
OMIM: 118190
HGNC: 5261
Ensembl: ENSG00000144381
Vega: OTTHUMG00000154463
Pharos: P10809(Tbio)
UniProt: P10809 A0A024R3X4
Structure
PDB: 

Position
2q33.1
AA seq 573 aa AA seqDB search
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggttacccacagtctttcgccagatgagaccggtgtccagggtactggctcct
catctcactcgggcttatgccaaagatgtaaaatttggtgcagatgcccgagccttaatg
cttcaaggtgtagaccttttagccgatgctgtggccgttacaatggggccaaagggaaga
acagtgattattgagcagagttggggaagtcccaaagtaacaaaagatggtgtgactgtt
gcaaagtcaattgacttaaaagataaatacaaaaacattggagctaaacttgttcaagat
gttgccaataacacaaatgaagaagctggggatggcactaccactgctactgtactggca
cgctctatagccaaggaaggcttcgagaagattagcaaaggtgctaatccagtggaaatc
aggagaggtgtgatgttagctgttgatgctgtaattgctgaacttaaaaagcagtctaaa
cctgtgaccacccctgaagaaattgcacaggttgctacgatttctgcaaacggagacaaa
gaaattggcaatatcatctctgatgcaatgaaaaaagttggaagaaagggtgtcatcaca
gtaaaggatggaaaaacactgaatgatgaattagaaattattgaaggcatgaagtttgat
cgaggctatatttctccatactttattaatacatcaaaaggtcagaaatgtgaattccag
gatgcctatgttctgttgagtgaaaagaaaatttctagtatccagtccattgtacctgct
cttgaaattgccaatgctcaccgtaagcctttggtcataatcgctgaagatgttgatgga
gaagctctaagtacactcgtcttgaataggctaaaggttggtcttcaggttgtggcagtc
aaggctccagggtttggtgacaatagaaagaaccagcttaaagatatggctattgctact
ggtggtgcagtgtttggagaagagggattgaccctgaatcttgaagacgttcagcctcat
gacttaggaaaagttggagaggtcattgtgaccaaagacgatgccatgctcttaaaagga
aaaggtgacaaggctcaaattgaaaaacgtattcaagaaatcattgagcagttagatgtc
acaactagtgaatatgaaaaggaaaaactgaatgaacggcttgcaaaactttcagatgga
gtggctgtgctgaaggttggtgggacaagtgatgttgaagtgaatgaaaagaaagacaga
gttacagatgcccttaatgctacaagagctgctgttgaagaaggcattgttttgggaggg
ggttgtgccctccttcgatgcattccagccttggactcattgactccagctaatgaagat
caaaaaattggtatagaaattattaaaagaacactcaaaattccagcaatgaccattgct
aagaatgcaggtgttgaaggatctttgatagttgagaaaattatgcaaagttcctcagaa
gttggttatgatgctatggctggagattttgtgaatatggtggaaaaaggaatcattgac
ccaacaaaggttgtgagaactgctttattggatgctgctggtgtggcctctctgttaact
acagcagaagttgtagtcacagaaattcctaaagaagagaaggaccctggaatgggtgca
atgggtggaatgggaggtggtatgggaggtggcatgttctaa

DBGET integrated database retrieval system