KEGG   Homo sapiens (human): 333
Entry
333               CDS       T01001                                 
Symbol
APLP1, APLP
Name
(RefSeq) amyloid beta precursor like protein 1
  KO
K05639  amyloid-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    333 (APLP1)
SSDB
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid IFRD Ints3_N
Other DBs
NCBI-GeneID: 333
NCBI-ProteinID: NP_005157
OMIM: 104775
HGNC: 597
Ensembl: ENSG00000105290
Pharos: P51693(Tbio)
UniProt: P51693
Structure
Position
19:35868574..35879792
AA seq 650 aa
MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLC
GRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWC
GGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEA
CSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPGTPDPSGTAVGDPSTRSWPPGSRVEGA
EDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGM
PGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALNEHFQSILQT
LEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE
QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQ
IQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKM
NPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSM
LLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggggcccgccagccccgctgctcgcggtctaagtcgccgcccgggccagccgccgctg
ccgctgctgctgccactattgctgctgcttctgcgcgcgcagcccgccatcgggagcctg
gccggtgggagccccggcgcggccgaggccccggggtcggcccaggtggctggactatgc
gggcgcctaacccttcaccgggacctgcgcaccggccgctgggaaccagacccacagcgc
tctcgacgctgtctccgggacccgcagcgcgtgctggagtactgcagacagatgtacccg
gagctgcagattgcacgtgtggagcaggctacgcaggccatccccatggagcgctggtgc
gggggttcccggagcggcagctgcgcccacccccaccaccaggttgtgcccttccgctgc
ctgcctggtgaatttgtgagtgaggccctgctggtgcctgaaggctgccggttcttgcac
caggagcgcatggaccaatgtgagagttcaacccggaggcatcaggaggcacaggaggcc
tgcagctcccagggcctcatcctgcacggctcgggcatgctcttaccctgtggctcggat
cggttccgtggtgtggagtatgtgtgctgtccccctccagggacccccgacccatctggg
acagcagttggtgacccctccacccggtcctggcccccggggagcagagtagagggggct
gaggacgaggaagaggaggaatccttcccacagccagtagatgattacttcgtggagcct
ccgcaggctgaagaggaagaggaaacggtcccacccccaagctcccatacacttgcagtg
gtcggcaaagtcactcccaccccgaggcccacagacggtgtggatatttactttggcatg
cctggggaaatcagtgagcacgaggggttcctgagggccaagatggacctggaggagcgt
aggatgcgccagattaatgaggtgatgcgtgaatgggccatggcagacaaccagtccaag
aacctgcctaaagccgacagacaggccctgaatgagcacttccagtccattctgcagact
ctggaggagcaggtgtctggtgagcgacagcgcctggtggaaacccacgccacccgcgtc
atcgcccttatcaacgaccagcgccgggctgccttggagggcttcctggcagccctgcag
gcagatccgcctcaggcggagcgtgtcctgttggccctgcggcgctacctgcgtgcggag
cagaaggaacagaggcacacgctgcgccactaccagcatgtggccgccgtggatcccgag
aaggcacagcagatgcgcttccaggtgcatacccaccttcaagtgattgaggagagggtg
aatcagagcctgggcctgcttgaccagaacccccacctggctcaggagctgcggccccaa
atccaggaactcctccactctgaacacctgggtcccagtgaattggaagcccctgcccct
gggggcagcagcgaggacaagggtgggctgcagcctccagattccaaggatgacaccccc
atgacccttccaaaagggtccacagaacaagatgctgcatcccctgagaaagagaagatg
aacccgctggaacagtatgagcgaaaggtgaatgcgtctgttccaaggggtttccctttc
cactcatcggagattcagagggatgagctggcaccagctgggacaggggtgtcccgtgag
gctgtgtcgggtctgctgatcatgggagcgggcggaggctccctcatcgtcctctccatg
ctgctcctgcgcaggaagaagccctacggggctatcagccatggcgtggtggaggtggac
cccatgctgaccctggaggagcagcagctccgcgaactgcagcggcacggctatgagaac
cccacttaccgcttcctggaggaacgaccctga

DBGET integrated database retrieval system