KEGG   Homo sapiens (human): 3337Help
Entry
3337              CDS       T01001                                 

Gene name
DNAJB1, HSPF1, Hdj1, Hsp40, RSPH16B, Sis1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B1
  KO
K09507  DnaJ homolog subfamily B member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3337 (DNAJB1)
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    3337 (DNAJB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3337 (DNAJB1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   3337 (DNAJB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ
Motif
Other DBs
NCBI-GeneID: 3337
NCBI-ProteinID: NP_006136
OMIM: 604572
HGNC: 5270
Ensembl: ENSG00000132002
Vega: OTTHUMG00000183289
Pharos: P25685(Tbio)
UniProt: P25685 Q6FHS4
Structure
PDB: 

Position
19p13.12
AA seq 340 aa AA seqDB search
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagactactaccagacgttgggcctggcccgcggcgcgtcggacgaggagatc
aagcgggcctaccgccgccaggcgctgcgctaccacccggacaagaacaaggagcccggc
gccgaggagaagttcaaggagatcgctgaggcctacgacgtgctcagcgacccgcgcaag
cgcgagatcttcgaccgctacggggaggaaggcctaaaggggagtggccccagtggcggt
agcggcggtggtgccaatggtacctctttcagctacacattccatggagaccctcatgcc
atgtttgctgagttcttcggtggcagaaatccctttgacaccttttttgggcagcggaac
ggggaggaaggcatggacattgatgacccattctctggcttccctatgggcatgggtggc
ttcaccaacgtgaactttggccgctcccgctctgcccaagagcccgcccgaaagaagcaa
gatcccccagtcacccacgaccttcgagtctcccttgaagagatctacagcggctgtacc
aagaagatgaaaatctcccacaagcggctaaaccccgacggaaagagcattcgaaacgaa
gacaaaatattgaccatcgaagtgaagaaggggtggaaagaaggaaccaaaatcactttc
cccaaggaaggagaccagacctccaacaacattccagctgatatcgtctttgttttaaag
gacaagccccacaatatctttaagagagatggctctgatgtcatttatcctgccaggatc
agcctccgggaggctctgtgtggctgcacagtgaacgtccccactctggacggcaggacg
atacccgtcgtattcaaagatgttatcaggcctggcatgcggcgaaaagttcctggagaa
ggcctccccctccccaaaacacccgagaaacgtggggacctcattattgagtttgaagtg
atcttccccgaaaggattccccagacatcaagaaccgtacttgagcaggttcttccaata
tag

DBGET integrated database retrieval system