KEGG   Homo sapiens (human): 3339Help
Entry
3339              CDS       T01001                                 

Gene name
HSPG2, HSPG, PLC, PRCAN, SJA, SJS, SJS1
Definition
(RefSeq) heparan sulfate proteoglycan 2
  KO
K06255  heparan sulfate proteoglycan 2 (perlecan)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa05161  Hepatitis B
hsa05205  Proteoglycans in cancer
Disease
H00493  Heparan sulfate proteoglycan gene defects
H01777  Schwartz-Jampel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3339 (HSPG2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3339 (HSPG2)
  Infectious diseases
   05161 Hepatitis B
    3339 (HSPG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3339 (HSPG2)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   3339 (HSPG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF C2-set_2 Ldl_recept_a Laminin_G_3 C2-set EGF hEGF
Motif
Other DBs
NCBI-GeneID: 3339
NCBI-ProteinID: NP_005520
OMIM: 142461
HGNC: 5273
Ensembl: ENSG00000142798
Vega: OTTHUMG00000002674
Pharos: P98160(Tbio)
UniProt: P98160
Structure
PDB: 

Position
1p36.12
AA seq 4391 aa AA seqDB search
MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDML
ADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEMLLRVISSGSVASYVTS
PQGFQFRRLGTVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLG
ISPTFSLLVETTSLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPR
DYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCP
TKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASR
GQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCE
AMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQI
RLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLLSRGHTPTQPGALNQR
QVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHAT
SHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVG
RLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAAS
THTTNEGIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPG
STPLHGQPLVVLQGNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMA
LAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDC
DTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQR
GTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQG
QPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPD
GCLPCFCMGITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGA
QLSFGNFAQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGN
NIMLVASQPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSV
PLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHC
ELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNP
ENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVE
VHPARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSD
AGVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSP
AYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQAS
GTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGILRL
PAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHAGRTVRLYCRAA
GVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQV
VVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGS
RLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPIRIEPSS
SHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCHV
VGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYK
RGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGST
QPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQASPA
DSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAEGQTLDLNCLV
AGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTI
QQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQI
VGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPT
VVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANN
NIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETLDLNCVVPGQAHAQVTW
HKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHV
PAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHKRGGNLPARHQVHGPLLRL
NQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQ
TLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHLVSPADSGEYVCRAASGPGPE
QEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRN
QELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEG
PVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLEQRTYGLMDSHAVLQISSAKPSDA
GTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPA
PTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPY
ATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDS
GRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFH
CAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGKAQASAQ
LVIQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVV
RIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASG
YPTPDISWSKLDGSLPPDSRLENNMLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPE
RVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRVPGSPTNLANRQ
PDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVN
GTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAH
GISHCPTCRDRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCV
NRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPL
APDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAER
LNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEV
SVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLC
EHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPG
QYGAYFHDDGFLAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFI
SLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSP
GPNVAVNAKGSVYIGGAPDVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRA
QAGANTRPCPS
NT seq 13176 nt NT seq  +upstreamnt  +downstreamnt
atggggtggcgggcggcgggcgcgctgctgctggcgctgctgctgcacgggcggctgctg
gcggtgacccatgggctgagggcatacgatggcttgtctctgcctgaggacatagagacc
gtcacagcaagccaaatgcgctggacacattcgtacctttctgatgatgaggacatgctg
gctgacagcatctcaggagacgacctgggcagtggggacctgggcagcggggacttccag
atggtttatttccgagccctggtgaatttcactcgctccatcgagtacagccctcagctg
gaggatgcaggctccagagagttccgagaggtgtccgaggctgtggtagacacgctggag
tcggagtacttgaaaattcccggagaccaggttgtcagtgtggtgttcatcaaggagctg
gatggctgggtttttgtggagctggatgtgggctcggaagggaatgcggatggggctcag
attcaggagatgctgctcagggtcatctccagcggctctgtggcctcctacgtcacctct
ccccagggattccagttccgacgcctgggcacagtgccccagttcccaagagcctgcacg
gaggccgagtttgcctgccacagctacaatgagtgtgtggccctggagtatcgctgtgac
cggcggcccgactgcagggacatgtctgatgagctcaattgtgaggagccagtcctgggt
atcagccccacattctctctccttgtggagacgacatctttaccgccccggccagagaca
accatcatgcgacagccaccagtcacccacgctcctcagcccctgcttcccggttccgtc
aggcccctgccctgtgggccccaggaggccgcatgccgcaatgggcactgcatccccaga
gactacctctgcgacggacaggaggactgcgaggacggcagcgatgagctagactgtggc
cccccgccaccctgtgagcccaacgagttcccctgcgggaatggacattgtgccctcaag
ctgtggcgctgcgatggtgactttgactgtgaggaccgaactgatgaagccaactgcccc
accaagcgtcctgaggaagtgtgcgggcccacacagttccgatgcgtctctaccaacatg
tgcatcccagccagcttccactgtgacgaggagagcgactgtcctgaccggagcgacgag
tttggctgcatgcccccccaggtggtgacacctccccgggagtccatccaggcttcccgg
ggccagacagtgaccttcacctgcgtggccattggcgtccccacccccatcatcaattgg
aggctcaactggggccacatcccctctcatcccagggtgacagtgaccagcgagggtggc
cgtggcacactgatcatccgtgatgtgaaggagtcagaccagggtgcctacacctgtgag
gccatgaacgcccggggcatggtgtttggcattcctgacggtgtccttgagctcgtccca
caacgaggcccctgccctgacggccacttctacctggagcacagcgccgcctgcctgccc
tgcttctgctttggcatcaccagcgtgtgccagagcacccgccgcttccgggaccagatc
aggctgcgctttgaccaacccgatgacttcaagggtgtgaatgtgacaatgcctgcgcag
cccggcacgccacccctctcctccacgcagctgcagatcgacccatccctgcacgagttc
cagctagtcgacctgtcccgccgcttcctcgtccacgactccttctgggctctgcctgaa
cagttcctgggcaacaaggtggactcctatggcggctccctgcgttacaacgtgcgctac
gagttggcccgtggcatgctggagccagtgcagcggccggacgtggtcctcatgggtgcc
gggtaccgcctcctctcccgaggccacacacccacccaacctggtgctctgaaccagcgc
caggtccagttctctgaggagcactgggtccatgagtctggccggccggtgcagcgcgcg
gagctgctgcaggtgctgcagagcctggaggccgtgctcatccagaccgtgtacaacacc
aagatggccagcgtgggacttagcgacatcgccatggataccaccgtcacccatgccacc
agccatggccgtgcccacagtgtggaggagtgcagatgccccattggctattctggcttg
tcctgcgagagctgtgatgcccacttcactcgggtgcctggtgggccctacctgggcacc
tgctctggttgcaattgcaatggccatgccagctcctgtgaccctgtgtatggccactgc
ctgaattgccagcacaacacggaggggccacagtgcaacaagtgcaaggctggcttcttt
ggggacgccatgaaggccacggccacttcctgccggccctgcccttgcccatacatcgat
gcctcccgcagattctcagacacttgcttcctggacacggatggccaagccacatgtgac
gcctgtgccccaggctacactggccgccgctgtgagagctgtgcccccggatacgagggc
aaccccatccagcccggcgggaagtgcaggcccgtcaaccaggagattgtgcgctgtgac
gagcgtggcagcatggggacctccggggaggcctgccgctgtaagaacaatgtggtgggg
cgcttgtgcaatgaatgtgctgacggctctttccacctgagtacccgaaaccccgatggc
tgcctcaagtgcttctgcatgggtgtcagtcgccactgcaccagctcttcatggagccgt
gcccagttgcatggggcctctgaggagcctggtcacttcagcctgaccaacgccgcaagc
acccacaccaccaacgagggcatcttctcccccacgcccggggaactgggattctcctcc
ttccacagactcttatctggaccctacttctggagcctcccttcacgcttcctgggggac
aaggtgacctcctatggaggagagctgcgcttcacagtgacccagaggtcccagccgggc
tccacacccctgcacgggcagccgttggtggtgctgcaaggtaacaacatcatcctagag
caccatgtggcccaggagcccagccccggccagcccagcaccttcattgtgcctttccgg
gagcaagcatggcagcggcccgatgggcagccagccacacgggagcacctgctgatggca
ctggcaggcatcgacaccctcctgatccgagcatcctacgcccagcagcccgctgagagc
agggtctctggcatcagcatggacgtggctgtgcccgaggaaaccggccaggaccccgcg
ctggaagtggaacagtgctcctgcccacccgggtaccgtgggccgtcctgccaggactgt
gacacaggctacacacgcacgcccagtggcctctacctgggtacctgtgaacgctgcagc
tgccatggccactcagaggcctgcgagccagaaacaggtgcctgccagggctgccagcat
cacacggagggccctcggtgtgagcagtgccagccaggatactacggggacgcccagcgg
gggacaccacaggactgccagctgtgcccctgctacggagaccctgctgccggccaggct
gcccacacttgttttctggacacagacggccaccccacctgtgatgcgtgctccccaggc
cacagtgggcgtcactgtgagaggtgcgcccctggctactatggcaaccccagccagggc
cagccatgccagagagacagccaggtgccagggcccataggctgcaactgtgacccccaa
ggcagcgtcagcagccagtgtgatgctgctggtcagtgccagtgcaaggcccaggtggaa
ggcctcacttgcagccactgccggccccaccacttccacctgagtgccagcaacccagac
ggctgcctgccctgcttctgtatgggcatcacccagcagtgcgccagctctgcctacaca
cgccacctgatctccacccactttgcccctggggacttccaaggctttgccctggtgaac
ccacagcgaaacagccgcctgacaggagaattcactgtggaacccgtgcccgagggtgcc
cagctctcttttggcaactttgcccaactcggccatgagtccttctactggcagctgccg
gagacataccagggagacaaggtggcggcctacggtgggaagttgcgatacaccctctcc
tacacagcaggcccacagggcagcccactctctgaccccgatgtgcagatcacgggcaac
aacatcatgctagtggcctcccagccagcgctgcagggccctgagaggaggagctacgag
atcatgttccgagaggaattctggcgccggcccgatgggcagccggccacacgcgagcac
ctcctgatggcactggccgacctggatgagctcctgatccgggccacgttctcctccgtg
ccgctggcggccagcatcagcgcagtcagcctggaggtcgcccagccggggccctcaaac
agaccccgcgccctcgaggtggaggagtgccgctgcccgccaggctacatcggtctgtcc
tgccaggactgtgcccccggctacacgcgcaccgggagtgggctctacctcggccactgc
gagctatgtgaatgcaatggccactcagacctgtgccacccagagactggggcctgctcg
caatgccagcacaacgccgcaggggagttctgcgagctttgtgcccctggctactacgga
gatgccacagccgggacgcctgaggactgccagccctgtgcctgcccactgaccaaccca
gagaacatgttttcccgcacctgtgagagcctgggagccggcgggtaccgctgcacggcc
tgcgaacccggctacactggccagtactgtgagcagtgtggcccaggttacgtgggtaac
cccagtgtgcaagggggccagtgcctgccagagacaaaccaagccccactggtggtcgag
gtccatcctgctcgaagcatagtgccccaaggtggctcccactccctgcggtgtcaggtc
agtgggagcccaccccactacttctattggtcccgtgaggatgggcggcctgtgcccagc
ggcacccagcagcgacatcaaggctccgagctccacttccccagcgtccagccctcggat
gctggggtctacatttgcacctgccgtaatctccaccaatccaataccagccgggcagag
ctgctggtcactgaggctccaagcaagcccatcacagtgactgtggaggagcagcggagc
cagagcgtgcgccccggagctgacgtcaccttcatctgcacagccaaaagcaagtcccca
gcctataccctggtgtggacccgcctgcacaacgggaaactgcccacccgagccatggat
ttcaatggcatcctgaccattcgcaacgtccagctgagtgatgcaggcacctacgtgtgc
accggctccaacatgtttgccatggaccagggcacagccactctacatgtgcaggcctcg
ggcaccttgtccgcccccgtggtctccatccatccgccacagctcacagtgcagcccggg
caactggcggagttccgctgcagcgccacagggagccccacgcccaccctcgagtggaca
gggggccccggcggccagctccctgcgaaggcacaaatccacggcggcatcctgcgcctg
ccagctgtcgagcccacggatcaggcccagtacttgtgccgagcccacagcagcgctggg
cagcaggtggccagggctgtgctccacgtgcatgggggcggtgggcccagagtccaagtg
agcccagagaggacccaggtccacgcaggccgcaccgtcaggctgtactgcagggctgca
ggcgtgcctagcgccaccatcacctggaggaaggaagggggcagcctcccaccacaggcc
cggtcagagcgcacagacatcgcgacactgctcatcccagccatcacgactgctgacgcc
ggcttctacctctgcgtggccaccagccctgcaggcactgcccaggcccggatccaagtg
gttgtcctttcagcctcagatgccagcccaccgccggtcaagattgagtcctcatcgcct
tctgtgacagaagggcaaacactcgacctcaactgtgtggtggcagggtcagcccatgcc
caggtcacctggtacaggcgagggggtagcctgcctccccacacccaggtgcacggctcc
cgtctgcggctcccccaggtctcaccagctgattctggagaatatgtgtgccgtgtggag
aatggatcgggccccaaggaggcctccattactgtgtctgtgctccacggcacccattct
ggccccagctacaccccagtgcccggcagcacccggcccatccgcatcgagccctcctcc
tcacacgtggcggaagggcagaccctggatctgaactgcgtggtgcccgggcaggcccac
gcccaggtcacgtggcacaagcgtgggggcagcctccctgcccggcaccagacccacggc
tcgctgctgcggctgcaccaggtgaccccggccgactcaggcgagtatgtgtgccatgtg
gtgggcacctccggccccctagaggcctcagtcctggtcaccatcgaagcctctgtcatc
cctggacccatcccacctgtcaggatcgagtcttcatcctccacagtggccgagggccag
accctggatctgagctgcgtggtggcagggcaggcccacgcccaggtcacatggtacaag
cgtgggggcagcctccctgcccggcaccaggttcgtggctcccgcctgtacatcttccag
gcctcacctgccgatgcgggacagtacgtctgccgggccagcaacggcatggaggcctcc
atcacggtcacagtaactgggacccagggggccaacttagcctaccctgccggcagcacc
cagcccatccgcatcgagccctcctcctcgcaagtggcggaagggcagaccctggatctg
aactgcgtggtgcccgggcagtcccatgcccaggtcacgtggcacaagcgtgggggcagc
ctccctgtccggcaccagacccacggctccctgctgagactctaccaagcgtcccccgcc
gactcgggcgagtacgtgtgccgagtgttgggcagctccgtgcctctagaggcctctgtc
ctggtcaccattgagcctgcgggctcagtgcctgcacttggggtcacccccacggtccgg
atcgagtcatcgtcttcgcaagtggccgaggggcagaccctggacctgaactgcctcgtt
gctggtcaggcccatgcccaggtcacgtggcacaagcgcgggggcagcctcccggcccgg
caccaggtgcatggctcgaggctacgcctgctccaggtgaccccagctgattcaggggag
tacgtgtgccgtgtggtcggcagctcaggtacccaggaagcctcagtccttgtcaccatc
cagcagcgccttagtggctcccactcccagggtgtggcgtaccccgtccgcatcgagtcc
tcctcagcctccctggccaatggacacaccctggacctcaactgcctggttgccagccag
gctccccacaccatcacctggtataagcgtggaggcagcttacccagccggcaccagatc
gtgggctcccggctgcggatccctcaggtgactccggcagactcgggcgagtacgtgtgt
cacgtcagtaacggtgcaggctcccgggagacctcgctcatcgtcaccatccagggcagc
ggttcctcccacgtgcccagcgtctccccaccgatcaggatcgagtcgtcttcccccacg
gtggtggaagggcagaccttggatctgaactgcgtggtcgccaggcagccccaggctatc
atcacatggtacaagcgtgggggcagccttccctcccgacaccagacccatggctcccac
ctgcggttgcaccaaatgtctgtggctgactcgggcgagtatgtgtgccgggccaacaac
aacatcgatgccctggaggcctccatcgtcatctccgtctcccctagcgccggcagcccc
tccgcccctggcagctccatgcccatcagaattgagtcatcctcctcacacgtggccgaa
ggggagaccctggatctgaactgcgtggtccccgggcaggcccatgcccaggtcacttgg
cacaagcgtgggggcagcctccccagtcaccatcagacccgcggctcacggctgcggctg
caccatgtgtccccggccgactcgggtgaatacgtgtgccgggtgatgggcagctctggc
cccctggaggcctcagtcctggtcaccatcgaagcctctggctcaagtgctgtccacgtc
cccgccccaggtggagccccacccatccgcatcgagccctcctcctcccgagtggcagaa
gggcagaccctggatctgaagtgcgtggtgcccgggcaggcccacgcccaggtcacgtgg
cacaagcgtggaggaaacctccctgcccggcaccaggtccacggcccactgctgaggctg
aaccaggtgtccccggctgactctggcgagtactcgtgccaagtgaccggaagctcaggc
accctggaggcatctgtcctggtcacaattgagccctccagcccaggacccattcctgct
ccaggactggcccagcccatctacatcgaggcctcctcttcacacgtgactgaagggcag
actctggatctgaactgtgtggtgcccgggcaggcccatgcccaggtcacgtggtacaag
cgcgggggcagcctccccgcccggcaccagacccatggctcccagctgcggctccacctc
gtctcccctgccgactcaggcgagtatgtgtgtcgtgcagccagcggcccaggccctgag
caagaagcctccttcacagtcaccgtcccgcccagtgaggggtcttcctaccgccttagg
agcccggtcatctccatcgacccgcccagcagcaccgtgcagcagggccaggatgccagc
ttcaagtgcctcatccatgacggggcagcccccatcagcctcgagtggaagacccggaac
caggagctggaggacaacgtccacatcagtcccaatggctccatcatcaccatcgtgggc
acccggcccagcaaccacggtacctaccgctgcgtggcctccaatgcctacggtgtggcc
cagagtgtggtgaacctcagtgtgcacgggccccctacagtgtccgtgctccccgagggc
cccgtgtgggtgaaagtgggaaaggctgtcaccctggagtgtgtcagtgccggggagccc
cgctcctctgctcgttggacccggatcagcagcacccctgccaagttggagcagcggaca
tatgggctcatggacagccacgcggtgctgcagatttcatcagctaaaccatcagatgcg
ggcacttatgtgtgccttgctcagaatgcactaggcacagcacagaagcaggtggaggtg
atcgtggacacgggcgccatggccccaggggcccctcaggtccaagctgaagaagctgag
ctgactgtggaggctggacacacggccaccttgcgctgctcagccacaggcagccccgcg
cccaccatccactggtccaagctgcgttccccactgccctggcagcaccggctggaaggt
gacacactcatcataccccgggtagcccagcaggactcgggccagtacatctgcaatgcc
actagccctgctgggcacgctgaggccaccatcatcctgcacgtggagagcccaccatat
gccaccacggtcccagagcacgcttcggtgcaggcaggggagacggtgcagctccagtgc
ctggctcacgggacacccccactcaccttccagtggagccgcgtgggcagcagccttcct
gggagggcgaccgccaggaacgagctgctgcactttgagcgtgcagcccctgaggactca
ggccgctaccgctgccgggtcaccaacaaggtgggctcagccgaggcctttgcccagctg
ctcgtccaaggccctcccggctctctccctgccacctccatcccagcagggtccacgccc
accgtgcaggtcacgcctcagctagagaccaagagcattggggccagcgttgagttccac
tgtgctgtgcccagcgaccggggtacccagctccgttggttcaaggaagggggtcagctg
cctccgggtcacagcgtgcaggatggggtgctccgaatccagaacttggaccagagctgc
caagggacgtatatatgccaggcccatggaccttgggggaaggcccaggccagtgcccag
ctggttatccaagccctgccctcggtgctcatcaacatccggacctctgtgcagaccgtg
gtggttggccacgccgtggagttcgaatgcctggcactgggtgaccccaagcctcaggtg
acatggagcaaagttggagggcacctgcggccaggcattgtgcagagcggaggtgtcgtc
aggatcgcccacgtagagctggctgatgcgggacagtatcgctgcactgccaccaacgca
gctggcaccacacaatcccacgtcctgctgcttgtgcaagccttgccccagatctcaatg
ccccaagaagtccgtgtgcctgctggttctgcagctgtcttcccctgcatagcctcaggc
taccccactcctgacatcagctggagcaagctggatggcagcctgccacctgacagccgc
ctggagaacaacatgctgatgctgccctcagtccgaccccaggacgcaggtacctacgtc
tgcaccgccactaaccgccagggcaaggtcaaagcctttgcccacctgcaggtgccagag
cgggtggtgccctacttcacgcagaccccctactccttcctaccgctgcccaccatcaag
gatgcctacaggaagttcgagatcaagatcaccttccggcccgactcagccgatgggatg
ctgctgtacaatgggcagaagcgagtcccagggagccccaccaacctggccaaccggcag
cccgacttcatctccttcggcctcgtggggggaaggcccgagttccggttcgatgcaggc
tcaggcatggccaccatccgccatcccacaccactggccctgggccatttccacaccgtg
accctgctgcgcagcctcacccagggctccctgattgtgggtgacctggccccggtcaat
gggacctcccagggcaagttccagggcctggatctgaacgaggaactctacctgggtggc
tatcctgactatggtgccatccccaaggcggggctgagcagcggcttcataggctgtgtc
cgggagctgcgcatccagggcgaggagatcgtcttccatgacctcaacctcacggcgcac
ggcatctcccactgccccacctgtcgggaccggccctgccagaatggcggtcagtgccat
gactctgagagcagcagctacgtgtgcgtctgcccagctggcttcaccgggagccgctgt
gagcactcgcaggccctgcactgccatccagaggcctgtgggcccgacgccacctgtgtg
aaccggcctgacggtcgaggctacacctgccgctgccacctgggccgctcggggttgcgg
tgtgaggaaggtgtgacagtgaccaccccctcgctgtcgggtgctggctcctacctggca
ctgcccgccctcaccaacacacaccacgagctacgcctggacgtggagttcaagccactc
gcccctgacggggtcctgctgttcagcggggggaagagcgggcctgtggaggacttcgtg
tccctggcgatggtgggcggccacctggagttccgctatgagttggggtcagggctggcc
gttctgcggagcgccgagccgctggccctgggccgctggcaccgtgtgtctgcagagcgt
ctcaacaaggacggcagcctgcgggtgaatggtggacgccctgtgctgcgctcctcgccc
ggcaagagccagggcctcaacctgcacaccctgctctacctggggggtgtggagccttcc
gtgccactgtccccggccaccaacatgagcgctcacttccgcggctgtgtgggcgaggtg
tcagtgaatggcaaacggctggacctcacctacagtttcctaggcagccagggcatcggg
caatgctatgatagctccccatgtgagcgccagccttgccaacatggtgccacgtgcatg
cccgctggcgagtatgagttccagtgcctgtgtcgagatggattcaaaggagacctgtgt
gagcacgaggagaacccctgccagctccgtgaaccctgtctgcatgggggcacctgccag
ggcacccgctgcctctgcctccctggcttctctggcccacgctgccaacaaggctctgga
catggcatagcagagtccgactggcatcttgaaggcagcgggggcaatgatgcccctggg
cagtacggagcctatttccacgatgatggcttcctcgccttccctggccatgtcttctcc
aggagcctgcccgaggtgcccgagaccatcgagctggaggttcggaccagcacagccagt
ggcctcctgctctggcagggtgtggaggtgggagaggccggccaaggcaaggacttcatc
agcctcgggcttcaagacgggcaccttgtcttcaggtaccagctgggtagtggggaggcc
cgcctggtctctgaggaccccatcaatgacggcgagtggcaccgggtgacagcactgcgg
gagggccgcagaggttccatccaagtcgacggtgaggagctggtcagcggccggtcccca
ggtcccaacgtggcagtcaacgccaagggcagcgtctacatcggcggagcccctgacgtg
gccacgctgaccgggggcagattctcctcaggcatcacaggctgtgtcaagaacctggtg
ctgcactcggcccgacccggcgccccgcccccacagcccctggacctgcagcaccgcgcc
caggccggggccaacacacgcccctgcccctcgtag

DBGET integrated database retrieval system