KEGG   Homo sapiens (human): 333932Help
Entry
333932            CDS       T01001                                 

Gene name
HIST2H3A, H3/n, H3/o
Definition
(RefSeq) histone cluster 2 H3 family member a
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    333932 (HIST2H3A)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    333932 (HIST2H3A)
  09165 Substance dependence
   05034 Alcoholism
    333932 (HIST2H3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    333932 (HIST2H3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    333932 (HIST2H3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    333932 (HIST2H3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   333932 (HIST2H3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 333932
NCBI-ProteinID: NP_001005464
HGNC: 20505
Ensembl: ENSG00000203852
Vega: OTTHUMG00000012094
UniProt: Q71DI3
Structure
PDB: 

Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

DBGET integrated database retrieval system