KEGG   Homo sapiens (human): 334Help
Entry
334               CDS       T01001                                 

Gene name
APLP2, APLP-2, APPH, APPL2, CDEBP
Definition
(RefSeq) amyloid beta precursor like protein 2
  KO
K08117  amyloid-like protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    334 (APLP2)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   334 (APLP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APP_E2 APP_N APP_amyloid APP_Cu_bd Kunitz_BPTI VHL_C Insulin_TMD SDA1
Motif
Other DBs
NCBI-GeneID: 334
NCBI-ProteinID: NP_001633
OMIM: 104776
HGNC: 598
Ensembl: ENSG00000084234
Vega: OTTHUMG00000165767
Pharos: Q06481(Tbio)
UniProt: Q06481
Structure
PDB: 

Position
11q24.3
AA seq 763 aa AA seqDB search
MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLN
MHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDK
KQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMT
LYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEF
PTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDK
EITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC
KAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQ
SDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERR
NQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFH
PFHPFPALPENEDTQPELYHPMKKGSGVGEQDGGLIGAEEKVINSKNKVDENMVIDETLD
VKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATVIVISLVMLRKRQ
YGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgggaccgcggccgccgcagccacgggcaggctcctgcttctgctgctg
gtggggctcacggcgcctgccttggcgctggccggctacatcgaggctcttgcagccaat
gccggaacaggatttgctgttgctgagcctcaaatcgcaatgttttgtgggaagttaaat
atgcatgtgaacattcagactgggaaatgggaacctgatccaacaggcaccaagagctgc
tttgaaacaaaagaagaagttcttcagtactgtcaggagatgtatccagagctacagatc
acaaatgtgatggaggcaaaccagcgggttagtattgacaactggtgccggagggacaaa
aagcaatgcaagagtcgctttgttacacctttcaagtgtctcgtgggtgaatttgtaagt
gatgtcctgctagttccagaaaagtgccagtttttccacaaagagcggatggaggtgtgt
gagaatcaccagcactggcacacggtagtcaaagaggcatgtctgactcagggaatgacc
ttatatagctacggcatgctgctcccatgtggggtagaccagttccatggcactgaatat
gtgtgctgccctcagacaaagattattggatctgtgtcaaaagaagaggaagaggaagat
gaagaggaagaggaagaggaagatgaagaggaagactatgatgtttataaaagtgaattt
cctactgaagcagatctggaagacttcacagaagcagctgtggatgaggatgatgaggat
gaggaagaaggggaggaagtggtggaggaccgagattactactatgacaccttcaaagga
gatgactacaatgaggagaatcctactgaacccggcagcgacggcaccatgtcagacaag
gaaattactcatgatgtcaaagctgtctgctcccaggaggcgatgacggggccctgccgg
gccgtgatgcctcgttggtacttcgacctctccaagggaaagtgcgtgcgctttatatat
ggtggctgcggcggcaacaggaacaattttgagtctgaggattattgtatggctgtgtgt
aaagcgatgattcctccaactcctctgccaaccaatgatgttgatgtgtatttcgagacc
tctgcagatgataatgagcatgctcgcttccagaaggctaaggagcagctggagattcgg
caccgcaaccgaatggacagggtaaagaaggaatgggaagaggcagagcttcaagctaag
aacctccccaaagcagagaggcagactctgattcagcacttccaagccatggttaaagct
ttagagaaggaagcagccagtgagaagcagcagctggtggagacccacctggcccgagtg
gaagctatgctgaatgaccgccgtcggatggctctggagaactacctggctgccttgcag
tctgacccgccacggcctcatcgcattctccaggccttacggcgttatgtccgtgctgag
aacaaagatcgcttacataccatccgtcattaccagcatgtgttggctgttgacccagaa
aaggcggcccagatgaaatcccaggtgatgacacatctccacgtgattgaagaaaggagg
aaccaaagcctctctctgctctacaaagtaccttatgtagcccaagaaattcaagaggaa
attgatgagctccttcaggagcagcgtgcagatatggaccagttcactgcctcaatctca
gagacccctgtggacgtccgggtgagctctgaggagagtgaggagatcccaccgttccac
cccttccaccccttcccagccctacctgagaacgaagacactcagccggagttgtaccac
ccaatgaaaaaaggatctggagtgggagagcaggatgggggactgatcggtgccgaagag
aaagtgattaacagtaagaataaagtggatgaaaacatggtcattgacgagactctggat
gttaaggaaatgattttcaatgccgagagagttggaggcctcgaggaagagcgggaatcc
gtgggcccactgcgggaggacttcagtctgagtagcagtgctctcattggcctgctggtc
atcgcagtggccattgccacggtcatcgtcatcagcctggtgatgctgaggaagaggcag
tatggcaccatcagccacgggatcgtggaggttgatccaatgctcaccccagaagagcgt
cacctgaacaagatgcagaaccatggctatgagaaccccacctacaaatacctggagcag
atgcagatttag

DBGET integrated database retrieval system