KEGG   Homo sapiens (human): 3347Help
Entry
3347              CDS       T01001                                 

Gene name
HTN3, HIS2, HTN2, HTN5
Definition
(RefSeq) histatin 3
  KO
K13913  histatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    3347 (HTN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AJAP1_PANP_C Antimicrobial10
Motif
Other DBs
NCBI-GeneID: 3347
NCBI-ProteinID: NP_000191
OMIM: 142702
HGNC: 5284
Ensembl: ENSG00000205649
Pharos: P15516(Tbio)
CPD: C15921
UniProt: P15516
Position
4q13.3
AA seq 51 aa AA seqDB search
MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttgtttttgctttaatcttggctctcatgctttccatgactggagctgat
tcacatgcaaagagacatcatgggtataaaagaaaattccatgaaaagcatcattcacat
cgaggctatagatcaaattatctgtatgacaattga

DBGET integrated database retrieval system