KEGG   Homo sapiens (human): 335Help
Entry
335               CDS       T01001                                 

Gene name
APOA1, apo(a)
Definition
(RefSeq) apolipoprotein A1
  KO
K08757  apolipoprotein A-I
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
hsa04979  Cholesterol metabolism
hsa05143  African trypanosomiasis
Disease
H00845  Familial amyloidosis
H00930  Hypoalphalipoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    335 (APOA1)
  09154 Digestive system
   04975 Fat digestion and absorption
    335 (APOA1)
   04979 Cholesterol metabolism
    335 (APOA1)
   04977 Vitamin digestion and absorption
    335 (APOA1)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05143 African trypanosomiasis
    335 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    335 (APOA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   335 (APOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH ApoLp-III DUF883 DHC_N1 Exonuc_VII_L DUF4455 DUF1640 Gp-FAR-1 DUF948 Gp58 OmpH DUF2894 DUF445 SidE Prominin DUF1664 Dynamin_M DUF4015 MIF4G_like_2 BshC KMP11 DUF4407 HAUS6_N LMP HIP1_clath_bdg RGS-like Muted THOC7
Motif
Other DBs
NCBI-GeneID: 335
NCBI-ProteinID: NP_000030
OMIM: 107680
HGNC: 600
Ensembl: ENSG00000118137
Vega: OTTHUMG00000046112
Pharos: P02647(Tbio)
UniProt: P02647 A0A024R3E3
Structure
PDB: 

Position
11q23.3
AA seq 267 aa AA seqDB search
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggtgctgaccttggccgtgctcttcctgacggggagccaggctcggcat
ttctggcagcaagatgaacccccccagagcccctgggatcgagtgaaggacctggccact
gtgtacgtggatgtgctcaaagacagcggcagagactatgtgtcccagtttgaaggctcc
gccttgggaaaacagctaaacctaaagctccttgacaactgggacagcgtgacctccacc
ttcagcaagctgcgcgaacagctcggccctgtgacccaggagttctgggataacctggaa
aaggagacagagggcctgaggcaggagatgagcaaggatctggaggaggtgaaggccaag
gtgcagccctacctggacgacttccagaagaagtggcaggaggagatggagctctaccgc
cagaaggtggagccgctgcgcgcagagctccaagagggcgcgcgccagaagctgcacgag
ctgcaagagaagctgagcccactgggcgaggagatgcgcgaccgcgcgcgcgcccatgtg
gacgcgctgcgcacgcatctggccccctacagcgacgagctgcgccagcgcttggccgcg
cgccttgaggctctcaaggagaacggcggcgccagactggccgagtaccacgccaaggcc
accgagcatctgagcacgctcagcgagaaggccaagcccgcgctcgaggacctccgccaa
ggcctgctgcccgtgctggagagcttcaaggtcagcttcctgagcgctctcgaggagtac
actaagaagctcaacacccagtga

DBGET integrated database retrieval system