KEGG   Homo sapiens (human): 3350Help
Entry
3350              CDS       T01001                                 

Gene name
HTR1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Adatanserin hydrochloride: D02767
Aripiprazole (DG00906): D01164 D10355 D10364 D10516
Asenapine: D02995
Bifeprunox (DG01304): D06566 D06567
Binospirone mesylate: D03121
Brexpiprazole: D10309
Buspirone (DG00913): D00702 D07593
Cariprazine (DG01305): D09876 D09997
Cinitapride (DG01520): D07700 D07701
Eptapirone: D02576
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679
Flesinoxan: D02568
Flibanserin: D02577
Gepirone: D04314
Indorenate hydrochloride: D04533
Ipsapirone hydrochloride: D04611
Lecozotan hydrochloride: D04683
Methysergide (DG00835): D00681 D02357
Naluzotan (DG01279): D09358 D09359
Pardoprunox (DG01324): D09366 D09397
Pipotiazine (DG00884): D02680 D08385
Pizotifen (DG00842): D05523 D08397
Sarizotan hydrochloride: D05804
Sunepitron hydrochloride: D02569
Tandospirone (DG01306): D01992 D08561
Tiospirone hydrochloride: D02688
Vilazodone (DG00964): D09698 D09699
Vortioxetine (DG00965): D10184 D10185
Xaliproden (DG01008): D01537 D06327
Zotepine: D01321
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3350 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3350 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3350 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    3350 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3350 (HTR1A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3350 (HTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 3350
NCBI-ProteinID: NP_000515
OMIM: 109760
HGNC: 5286
Ensembl: ENSG00000178394
Vega: OTTHUMG00000162279
Pharos: P08908(Tclin)
UniProt: P08908 Q5ZGX3 A8K5W4
Position
5q12.3
AA seq 422 aa AA seqDB search
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctcagccctggtcagggcaacaacaccacatcaccaccggctccctttgag
accggcggcaacactactggtatctccgacgtgaccgtcagctaccaagtgatcacctct
ctgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccttggagcgctccctgcagaacgtggccaattatcttattggctctttggcggtc
accgacctcatggtgtcggtgttggtgctgcccatggccgcgctgtatcaggtgctcaac
aagtggacactgggccaggtaacctgcgacctgttcatcgccctcgacgtgctgtgctgc
acctcatccatcttgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatctctatcccgcccatgctgggctggcgcaccccggaagac
cgctcggaccccgacgcatgcaccattagcaaggatcatggctacactatctattccacc
tttggagctttctacatcccgctgctgctcatgctggttctctatgggcgcatattccga
gctgcgcgcttccgcatccgcaagacggtcaaaaaggtggagaagaccggagcggacacc
cgccatggagcatctcccgccccgcagcccaagaagagtgtgaatggagagtcggggagc
aggaactggaggctgggcgtggagagcaaggctgggggtgctctgtgcgccaatggcgcg
gtgaggcaaggtgacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcacttgcctctgcccagcgaggctggtcctaccccttgtgcccccgcctct
ttcgagaggaaaaatgagcgcaacgccgaggcgaagcgcaagatggccctggcccgagag
aggaagacagtgaagacgctgggcatcatcatgggcaccttcatcctctgctggctgccc
ttcttcatcgtggctcttgttctgcccttctgcgagagcagctgccacatgcccaccctg
ttgggcgccataatcaattggctgggctactccaactctctgcttaaccccgtcatttac
gcatacttcaacaaggactttcaaaacgcgtttaagaagatcattaagtgtaagttctgc
cgccagtga

DBGET integrated database retrieval system