KEGG   Homo sapiens (human): 3351Help
Entry
3351              CDS       T01001                                 

Gene name
HTR1B, 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Almotriptan (DG00839): D02824 D02825
Alniditan dihydrochloride: D02826
Avitriptan fumarate: D03014
Cinitapride (DG01520): D07700 D07701
Dihydroergotamine (DG00833): D02211 D07837 D07838
Eletriptan (DG00840): D01973 D07887
Elzasonan (DG01314): D03982 D03983
Frovatriptan (DG00841): D04264 D07997
Indorenate hydrochloride: D04533
Naratriptan (DG00837): D00674 D08255
Pizotifen (DG00842): D05523 D08397
Rizatriptan (DG00838): D00675 D05740 D08485
Sumatriptan (DG00836): D00451 D00676
Zolmitriptan: D00415
Zotepine: D01321
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3351 (HTR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3351 (HTR1B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3351 (HTR1B)
  09157 Sensory system
   04742 Taste transduction
    3351 (HTR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3351 (HTR1B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3351 (HTR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 3351
NCBI-ProteinID: NP_000854
OMIM: 182131
HGNC: 5287
Ensembl: ENSG00000135312
Vega: OTTHUMG00000015066
Pharos: P28222(Tclin)
UniProt: P28222 X5D7I5 A8K215
Structure
PDB: 

Position
6q14.1
AA seq 390 aa AA seqDB search
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccgggtgctcagtgcgctccaccgccgcccgcgggctccgagacctgggtt
cctcaagccaacttatcctctgctccctcccaaaactgcagcgccaaggactacatttac
caggactccatctccctaccctggaaagtactgctggttatgctattggcgctcatcacc
ttggccaccacgctctccaatgcctttgtgattgccacagtgtaccggacccggaaactg
cacaccccggctaactacctgatcgcctctctggcggtcaccgacctgcttgtgtccatc
ctggtgatgcccatcagcaccatgtacactgtcaccggccgctggacactgggccaggtg
gtctgtgacttctggctgtcgtcggacatcacttgttgcactgcctccatcctgcacctc
tgtgtcatcgccctggaccgctactgggccatcacggacgccgtggagtactcagctaaa
aggactcccaagagggcggcggtcatgatcgcgctggtgtgggtcttctccatctctatc
tcgctgccgcccttcttctggcgtcaggctaaggccgaagaggaggtgtcggaatgcgtg
gtgaacaccgaccacatcctctacacggtctactccacggtgggtgctttctacttcccc
accctgctcctcatcgccctctatggccgcatctacgtagaagcccgctcccggattttg
aaacagacgcccaacaggaccggcaagcgcttgacccgagcccagctgataaccgactcc
cccgggtccacgtcctcggtcacctctattaactcgcgggttcccgacgtgcccagcgaa
tccggatctcctgtgtatgtgaaccaagtcaaagtgcgagtctccgacgccctgctggaa
aagaagaaactcatggccgctagggagcgcaaagccaccaagaccctagggatcattttg
ggagcctttattgtgtgttggctacccttcttcatcatctccctagtgatgcctatctgc
aaagatgcctgctggttccacctagccatctttgacttcttcacatggctgggctatctc
aactccctcatcaaccccataatctataccatgtccaatgaggactttaaacaagcattc
cataaactgatacgttttaagtgcacaagttga

DBGET integrated database retrieval system