KEGG   Homo sapiens (human): 3357Help
Entry
3357              CDS       T01001                                 

Gene name
HTR2B, 5-HT(2B), 5-HT-2B, 5-HT2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: D02767
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Cinitapride (DG01520): D07700 D07701
Dimetotiazine (DG00843): D01902 D07854
Fenfluramine (DG00103): D04148 D07945
Flibanserin: D02577
Glemanserin: D04320
Iloperidone: D02666
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563 D11056
Olanzapine (DG00898): D00454 D06623
Opipramol (DG00930): D01477 D08297
Pelanserin hydrochloride: D05395
Periciazine: D01485
Pizotifen (DG00842): D05523 D08397
Trazodone (DG00952): D00820 D08626
Tropanserin hydrochloride: D06253
Vabicaserin hydrochloride: D06660
Xylamidine tosylate: D06343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3357 (HTR2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3357 (HTR2B)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    3357 (HTR2B)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3357 (HTR2B)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3357 (HTR2B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3357 (HTR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 3357
NCBI-ProteinID: NP_000858
OMIM: 601122
HGNC: 5294
Ensembl: ENSG00000135914
Vega: OTTHUMG00000133222
Pharos: P41595(Tclin)
UniProt: P41595
Position
2q37.1
AA seq 481 aa AA seqDB search
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaattcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtttca
ctggagaagaagctgcagtatgctactaattactttctaatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttatttcttgacgttctcttttcaacc
gcatccatcatgcatctctgtgccatttcagtggatcgttacatagccatcaaaaagcca
atccaggccaatcaatataactcacgggctacagcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccagtccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcgatttcatgctcttt
ggctcactggctgccttcttcacacctcttgcaattatgattgtcacctactttctcact
atccatgctttacagaagaaggcttacttagtcaaaaacaagccacctcaacgcctaaca
tggttgactgtgtctacagttttccaaagggatgaaacaccttgctcgtcaccggaaaag
gtggcaatgctggatggttctcgaaaggacaaggctctgcccaactcaggtgatgaaaca
cttatgcgaagaacatccacaattgggaaaaagtcagtgcagaccatttccaacgaacag
agagcctcaaaggtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaatataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtctac
accctcttcaataagacatttcgggatgcatttggccgatatatcacctgcaattaccgg
gccacaaagtcagtaaaaactctcagaaaacgctccagtaagatctacttccggaatcca
atggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaaccctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacgcttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttat
gtatag

DBGET integrated database retrieval system