KEGG   Homo sapiens (human): 3357Help
Entry
3357              CDS       T01001                                 

Gene name
HTR2B, 5-HT(2B), 5-HT-2B, 5-HT2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: D02767
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Cinitapride (DG01520): D07700 D07701
Dimetotiazine (DG00843): D01902 D07854
Fenfluramine (DG00103): D04148 D07945
Flibanserin: D02577
Glemanserin: D04320
Iloperidone: D02666
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563 D11056
Ocaperidone: D02675
Olanzapine (DG00898): D00454 D06623
Opipramol (DG00930): D01477 D08297
Pelanserin hydrochloride: D05395
Periciazine: D01485
Pizotifen (DG00842): D05523 D08397
Sergolexole maleate: D05829
Setoperone: D02686
Tiospirone hydrochloride: D02688
Trazodone (DG00952): D00820 D08626
Tropanserin hydrochloride: D06253
Xylamidine tosylate: D06343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3357 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3357 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3357 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3357 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3357 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3357 (HTR2B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3357 (HTR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 3357
NCBI-ProteinID: NP_000858
OMIM: 601122
HGNC: 5294
Ensembl: ENSG00000135914
Vega: OTTHUMG00000133222
Pharos: P41595(Tclin)
UniProt: P41595
Position
2q37.1
AA seq 481 aa AA seqDB search
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaattcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtttca
ctggagaagaagctgcagtatgctactaattactttctaatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttatttcttgacgttctcttttcaacc
gcatccatcatgcatctctgtgccatttcagtggatcgttacatagccatcaaaaagcca
atccaggccaatcaatataactcacgggctacagcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccagtccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcgatttcatgctcttt
ggctcactggctgccttcttcacacctcttgcaattatgattgtcacctactttctcact
atccatgctttacagaagaaggcttacttagtcaaaaacaagccacctcaacgcctaaca
tggttgactgtgtctacagttttccaaagggatgaaacaccttgctcgtcaccggaaaag
gtggcaatgctggatggttctcgaaaggacaaggctctgcccaactcaggtgatgaaaca
cttatgcgaagaacatccacaattgggaaaaagtcagtgcagaccatttccaacgaacag
agagcctcaaaggtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaatataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtctac
accctcttcaataagacatttcgggatgcatttggccgatatatcacctgcaattaccgg
gccacaaagtcagtaaaaactctcagaaaacgctccagtaagatctacttccggaatcca
atggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaaccctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacgcttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttat
gtatag

DBGET integrated database retrieval system