KEGG   Homo sapiens (human): 3358Help
Entry
3358              CDS       T01001                                 

Gene name
HTR2C, 5-HT1C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: D02767
Agomelatine: D02578
Amesergide: D02893
Asenapine: D02995
Captodiame: D07316
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Cinanserin hydrochloride: D03506
Cinitapride (DG01520): D07700 D07701
Clozapine: D00283
Cyamemazine (DG00872): D07307 D07756
Dimetotiazine (DG00843): D01902 D07854
Fenfluramine (DG00103): D04148 D07945
Flibanserin: D02577
Glemanserin: D04320
Idalopirdine (DG01878): D10710
Iloperidone: D02666
Lorcaserin: D06613
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563 D11056
Nefazodone (DG00953): D00819 D08257
Ocaperidone: D02675
Olanzapine (DG00898): D00454 D06623
Opipramol (DG00930): D01477 D08297
Pelanserin hydrochloride: D05395
Periciazine: D01485
Pizotifen (DG00842): D05523 D08397
Ritanserin: D05738
Sergolexole maleate: D05829
Setoperone: D02686
Tedatioxetine (DG01311): D10170 D10171
Tiospirone hydrochloride: D02688
Trazodone (DG00952): D00820 D08626
Tropanserin hydrochloride: D06253
Vabicaserin hydrochloride: D06660
Xylamidine tosylate: D06343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3358 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3358 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3358 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3358 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3358 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3358 (HTR2C)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3358 (HTR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF1385 UPF0182 Pox_P21
Motif
Other DBs
NCBI-GeneID: 3358
NCBI-ProteinID: NP_000859
OMIM: 312861
HGNC: 5295
Ensembl: ENSG00000147246
Vega: OTTHUMG00000022226
Pharos: P28335(Tclin)
UniProt: P28335
Position
Xq23
AA seq 458 aa AA seqDB search
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacctgaggaatgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgtgatatttctgtgagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcatcataataatcatgacaataggtggcaacatccttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtatcagttcctatccctgtgattggactgagggacgaagaaaaggtg
ttcgtgaacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacgattatggtgattacgtattgcctgaccatctacgtt
ctgcgccgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagt
ctggatttcctgaagtgctgcaagaggaatacggccgaggaagagaactctgcaaaccct
aaccaagaccagaacgcacgccgaagaaagaagaaggagagacgtcctaggggcaccatg
caggctatcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgttt
ctgatcatgtggtgcccatttttcattaccaatattctgtctgttctttgtgagaagtcc
tgtaaccaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgt
tcaggaatcaatcctctggtgtatactctgttcaacaaaatttaccgaagggcattctcc
aactatttgcgttgcaattataaggtagagaaaaagcctcctgtcaggcagattccaaga
gttgccgccactgctttgtctgggagggagcttaatgttaacatttatcggcataccaat
gaaccggtgatcgagaaagccagtgacaatgagcccggtatagagatgcaagttgagaat
ttagagttaccagtaaatccctccagtgtggttagcgaaaggattagcagtgtgtga

DBGET integrated database retrieval system