KEGG   Homo sapiens (human): 3359Help
Entry
3359              CDS       T01001                                 

Gene name
HTR3A, 5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829 D07129
Azasetron (DG01521): D01613 D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Cisapride (DG00056): D00274 D02092
Clozapine: D00283
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725 D07867
Fabesetron hydrochloride: D01838
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Mirtazapine (DG02838): D00563 D11056
Ondansetron (DG00060): D00456 D00678
Palonosetron (DG00064): D05343 D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016 D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185
Zacopride hydrochloride: D06353
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3359 (HTR3A)
  09157 Sensory system
   04742 Taste transduction
    3359 (HTR3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3359 (HTR3A)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   3359 (HTR3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 3359
NCBI-ProteinID: NP_000860
OMIM: 182139
HGNC: 5297
Ensembl: ENSG00000166736
Vega: OTTHUMG00000160494
Pharos: P46098(Tclin)
UniProt: P46098 B4E398
Position
11q23.2
AA seq 484 aa AA seqDB search
MLGKLAMLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRD
WRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDS
IWVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLT
FTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKF
YVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDT
LPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWL
LCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLA
VCGLLQELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSI
WQYA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaagctcgctatgctgctgtgggtccagcaggcgctgctcgccttgctcctc
cccacactcctggcacagggagaagccaggaggagccgaaacaccaccaggcccgctctg
ctgaggctgtcggattaccttttgaccaactacaggaagggtgtgcgccccgtgagggac
tggaggaagccaaccaccgtatccattgacgtcattgtctatgccatcctcaacgtggat
gagaagaatcaggtgctgaccacctacatctggtaccggcagtactggactgatgagttt
ctccagtggaaccctgaggactttgacaacatcaccaagttgtccatccccacggacagc
atctgggtcccggacattctcatcaatgagttcgtggatgtggggaagtctccaaatatc
ccgtacgtgtatattcggcatcaaggcgaagttcagaactacaagccccttcaggtggtg
actgcctgtagcctcgacatctacaacttccccttcgatgtccagaactgctcgctgacc
ttcaccagttggctgcacaccatccaggacatcaacatctctttgtggcgcttgccagaa
aaggtgaaatccgacaggagtgtcttcatgaaccagggagagtgggagttgctgggggtg
ctgccctactttcgggagttcagcatggaaagcagtaactactatgcagaaatgaagttc
tatgtggtcatccgccggcggcccctcttctatgtggtcagcctgctactgcccagcatc
ttcctcatggtcatggacatcgtgggcttctacctgccccccaacagtggcgagagggtc
tctttcaagattacactcctcctgggctactcggtcttcctgatcatcgtttctgacacg
ctgccggccactgccatcggcactcctctcattggtgtctactttgtggtgtgcatggct
ctgctggtgataagtttggccgagaccatcttcattgtgcggctggtgcacaagcaagac
ctgcagcagcccgtgcctgcttggctgcgtcacctggttctggagagaatcgcctggcta
ctttgcctgagggagcagtcaacttcccagaggcccccagccacctcccaagccaccaag
actgatgactgctcagccatgggaaaccactgcagccacatgggaggaccccaggacttc
gagaagagcccgagggacagatgtagccctcccccaccacctcgggaggcctcgctggcg
gtgtgtgggctgctgcaggagctgtcctccatccggcaattcctggaaaagcgggatgag
atccgagaggtggcccgagactggctgcgcgtgggctccgtgctggacaagctgctattc
cacatttacctgctagcggtgctggcctacagcatcaccctggttatgctctggtccatc
tggcagtacgcttga

DBGET integrated database retrieval system