KEGG   Homo sapiens (human): 336Help
Entry
336               CDS       T01001                                 

Gene name
APOA2, Apo-AII, ApoA-II, apoAII
Definition
(RefSeq) apolipoprotein A2
  KO
K08758  apolipoprotein A-II
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04979  Cholesterol metabolism
Disease
H00845  Familial amyloidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    336 (APOA2)
  09154 Digestive system
   04979 Cholesterol metabolism
    336 (APOA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    336 (APOA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   336 (APOA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoA-II
Motif
Other DBs
NCBI-GeneID: 336
NCBI-ProteinID: NP_001634
OMIM: 107670
HGNC: 601
Ensembl: ENSG00000158874
Vega: OTTHUMG00000034346
Pharos: P02652(Tbio)
UniProt: P02652
Position
1q23.3
AA seq 100 aa AA seqDB search
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctcgcagcaactgtgctactcctcaccatctgcagccttgaaggagctttg
gttcggagacaggcaaaggagccatgtgtggagagcctggtttctcagtacttccagacc
gtgactgactatggcaaggacctgatggagaaggtcaagagcccagagcttcaggccgag
gccaagtcttactttgaaaagtcaaaggagcagctgacacccctgatcaagaaggctgga
acggaactggttaacttcttgagctatttcgtggaacttggaacacagcctgccacccag
tga

DBGET integrated database retrieval system