KEGG   Homo sapiens (human): 3360Help
Entry
3360              CDS       T01001                                 

Gene name
HTR4, 5-HT4, 5-HT4R
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Dazopride fumarate: D03662
Fabesetron hydrochloride: D01838
Mosapride (DG01285): D01994 D08236
Naronapride (DG01335): D09933 D09934
Piboserod hydrochloride: D05471
Prucalopride (DG00080): D09205 D10152
Renzapride: D06396
Sulamserod hydrochloride: D05941
Tegaserod (DG00081): D02730 D06056
Velusetrag (DG01336): D09693 D09694
Zacopride hydrochloride: D06353
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3360 (HTR4)
   04024 cAMP signaling pathway
    3360 (HTR4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3360 (HTR4)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3360 (HTR4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3360 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 3360
NCBI-ProteinID: NP_000861
OMIM: 602164
HGNC: 5299
Ensembl: ENSG00000164270
Vega: OTTHUMG00000129931
Pharos: Q13639(Tclin)
UniProt: Q13639 A0A2D3FAF9
Position
5q32
AA seq 388 aa AA seqDB search
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttctgaggagggtttcgggtcagtggagaaggtg
gtgctgctcacgtttctctcgacggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgctgggacaggcagctcaggaaaataaaaacaaattatttcattgta
tctcttgcttttgcggatctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggaggtgttttgtcttgttcggacatctctggac
gtcctgctcacaacggcatcgatttttcacctgtgctgcatttctctggataggtattac
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccacgtttatttcttttctccctataatgcaaggc
tggaataacattggcataattgatttgatagaaaagaggaagttcaaccagaactctaac
tctacgtactgtgtcttcatggtcaacaagccctacgccatcacctgctctgtggtggcc
ttctacatcccatttctcctcatggtgctggcctattaccgcatctatgtcacagctaag
gagcatgcccatcagatccagatgttacaacgggcaggagcctcctccgagagcaggcct
cagtcggcagaccagcatagcactcatcgcatgaggacagagaccaaagcagccaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggcaccattctttgtcaccaatatt
gtggatcctttcatagactacactgtccctgggcaggtgtggactgctttcctctggctc
ggctatatcaattccgggttgaacccttttctctacgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccttccattctg
ggccagactgtcccttgttcaaccacaaccattaatggatccacacatgtactaagggat
gcagtggagtgtggtggccagtgggagagtcagtgtcacccgccagcaacttctcctttg
gtggctgctcagcccagtgacacttag

DBGET integrated database retrieval system