KEGG   Homo sapiens (human): 3361Help
Entry
3361              CDS       T01001                                 

Gene name
HTR5A, 5-HT5A
Definition
(RefSeq) 5-hydroxytryptamine receptor 5A
  KO
K04161  5-hydroxytryptamine receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3361 (HTR5A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3361 (HTR5A)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3361 (HTR5A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3361 (HTR5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 3361
NCBI-ProteinID: NP_076917
OMIM: 601305
HGNC: 5300
Ensembl: ENSG00000157219
Vega: OTTHUMG00000151327
Pharos: P47898(Tchem)
UniProt: P47898 A4D2N2
Position
7q36.2
AA seq 357 aa AA seqDB search
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatttacctgtgaacctaacctccttttccctctccaccccctcccctttggagacc
aaccacagcctcggcaaagacgacctgcgccccagctcgcccctgctctcggtcttcgga
gtgcttattctcaccttgctgggctttctggtggcggcgacgttcgcctggaacctgctg
gtgctggcgaccatcctccgtgtacgcaccttccaccgcgtgccccacaacctggtggca
tccatggccgtctcggatgtcctggtggccgcgctggtcatgccgctgagcctggtgcac
gagctgtccgggcgccgctggcagctaggtcggaggctgtgccagctttggatcgcgtgc
gacgtgctttgctgcacggccagcatctggaacgtgacggccatagccctggaccgctac
tggtccatcacgcgccacatggaatacacgctccgcacccgcaagtgcgtctccaacgtc
atgatcgcgctcacctgggcactctccgctgtcatctctctggccccgctgctttttggc
tggggagagacgtactctgagggcagcgaggagtgccaggtaagccgcgagccttcctac
gccgtgttctccaccgtaggcgccttctacctgccgctctgtgtggtgctcttcgtgtac
tggaagatctacaaggctgccaagttccgcgtgggctccaggaagaccaatagcgtctca
cccatatccgaagctgtggaggtgaaggactctgccaaacagccccagatggtgttcacg
gtccgccacgccaccgtcaccttccagccagaaggggacacgtggcgggagcagaaggag
cagcgggccgccctcatggtgggcatcctcattggcgtgttcgtgctctgctggatcccc
ttctttctcaccgagctcatcagtcccctctgctcctgtgacatccccgccatctggaaa
agcatcttcctgtggcttggctactccaactccttctttaaccccctgatctatacggct
ttcaacaagaactacaacagcgccttcaagaacttcttttctaggcaacactga

DBGET integrated database retrieval system