KEGG   Homo sapiens (human): 337Help
Entry
337               CDS       T01001                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    337 (APOA4)
   04979 Cholesterol metabolism
    337 (APOA4)
   04977 Vitamin digestion and absorption
    337 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein ApoLp-III Baculo_PEP_C YtxH DUF883 DUF1845 Gp58 KapB TEA Apo-CIII DUF1640 Prominin OmpH BshC VirE Fzo_mitofusin ApoC-I
Motif
Other DBs
NCBI-GeneID: 337
NCBI-ProteinID: NP_000473
OMIM: 107690
HGNC: 602
Ensembl: ENSG00000110244
Vega: OTTHUMG00000046110
Structure
PDB: 

Position
11q23.3
AA seq 396 aa AA seqDB search
MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEV
SQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgaccctggccctggtggctgtcgccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggag
gagattgggaaggagctggaggagctgagggcccggctgctgccccatgccaatgaggtg
agccagaagatcggggacaacctgcgagagcttcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcagcacgcaggccgagcagctgcggcgccagctgaccccctac
gcacagcgcatggagagagtgctgcgggagaacgccgacagcctgcaggcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgctgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacacgcaggagaagctcaaccaccagcttgagggc
ctgaccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggccgaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccagcaggtg
gaggagttccgacgccgggtggagccctacggggaaaacttcaacaaagccctggtgcag
cagatggaacagctcaggcagaaactgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagactctctccctccctgagctggagcaacagcaggaacagcag
caggagcagcagcaggagcaggtgcagatgctggcccctttggagagctga

DBGET integrated database retrieval system