KEGG   Homo sapiens (human): 3375Help
Entry
3375              CDS       T01001                                 

Gene name
IAPP, DAP, IAP
Definition
(RefSeq) islet amyloid polypeptide
  KO
K08039  islet amyloid polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3375 (IAPP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    3375 (IAPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calc_CGRP_IAPP
Motif
Other DBs
NCBI-GeneID: 3375
NCBI-ProteinID: NP_000406
OMIM: 147940
HGNC: 5329
Ensembl: ENSG00000121351
Vega: OTTHUMG00000169128
Pharos: P10997(Tbio)
CPD: C16130
UniProt: P10997 A0A024RAU1
Structure
PDB: 

Position
12p12.1
AA seq 89 aa AA seqDB search
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNAVEVLKREPLNYLPL
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcctgaagctgcaagtatttctcattgtgctctctgttgcattgaaccatctg
aaagctacacccattgaaagtcatcaggtggaaaagcggaaatgcaacactgccacatgt
gcaacgcagcgcctggcaaattttttagttcattccagcaacaactttggtgccattctc
tcatctaccaacgtgggatccaatacatatggcaagaggaatgcagtagaggttttaaag
agagagccactgaattacttgcccctttag

DBGET integrated database retrieval system