KEGG   Homo sapiens (human): 3376
Entry
3376              CDS       T01001                                 

Gene name
IARS1, GRIDHH, IARS, ILERS, ILRS, IRS, PRO0785
Definition
(RefSeq) isoleucyl-tRNA synthetase 1
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H02437  Growth retardation, impaired intellectual development, hypotonia, and hepatopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    3376 (IARS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    3376 (IARS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    3376 (IARS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     3376 (IARS1)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   3376 (IARS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    3376 (IARS1)
 Prokaryotic type
   Other AARSs
    3376 (IARS1)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e
Other DBs
NCBI-GeneID: 3376
NCBI-ProteinID: NP_002152
OMIM: 600709
HGNC: 5330
Ensembl: ENSG00000196305
Vega: OTTHUMG00000020219
Pharos: P41252(Tchem)
UniProt: P41252 Q7L4K8 Q6P0M4
Position
9q22.31
AA seq 1262 aa
MLQQVPENINFPAEEEKILEFWTEFNCFQECLKQSKHKPKFTFYDGPPFATGLPHYGHIL
AGTIKDIVTRYAHQSGFHVDRRFGWDCHGLPVEYEIDKTLGIRGPEDVAKMGITEYNNQC
RAIVMRYSAEWKSTVSRLGRWIDFDNDYKTLYPQFMESVWWVFKQLYDKGLVYRGVKVMP
FSTACNTPLSNFESHQNYKDVQDPSVFVTFPLEEDETVSLVAWTTTPWTLPSNLAVCVNP
EMQYVKIKDVARGRLLILMEARLSALYKLESDYEILERFPGAYLKGKKYRPLFDYFLKCK
ENGAFTVLVDNYVKEEEGTGVVHQAPYFGAEDYRVCMDFNIIRKDSLPVCPVDASGCFTT
EVTDFAGQYVKDADKSIIRTLKEQGRLLVATTFTHSYPFCWRSDTPLIYKAVPSWFVRVE
NMVDQLLRNNDLCYWVPELVREKRFGNWLKDARDWTISRNRYWGTPIPLWVSDDFEEVVC
IGSVAELEELSGAKISDLHRESVDHLTIPSRCGKGSLHRISEVFDCWFESGSMPYAQVHY
PFENKREFEDAFPADFIAEGIDQTRGWFYTLLVLATALFGQPPFKNVIVNGLVLASDGQK
MSKRKKNYPDPVSIIQKYGADALRLYLINSPVVRAENLRFKEEGVRDVLKDVLLPWYNAY
RFLIQNVLRLQKEEEIEFLYNENTVRESPNITDRWILSFMQSLIGFFETEMAAYRLYTVV
PRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELM
YQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKT
IPIKYPLKEIVVIHQDPEALKDIKSLEKYIIEELNVRKVTLSTDKNKYGIRLRAEPDHMV
LGKRLKGAFKAVMTSIKQLSSEELEQFQKTGTIVVEGHELHDEDIRLMYTFDQATGGTAQ
FEAHSDAQALVLLDVTPDQSMVDEGMAREVINRIQKLRKKCNLVPTDEITVYYKAKSEGT
YLNSVIESHTEFIFTTIKAPLKPYPVSPSDKVLIQEKTQLKGSELEITLTRGSSLPGPAC
AYVNLNICANGSEQGGVLLLENPKGDNRLDLLKLKSVVTSIFGVKNTELAVFHDETEIQN
QTDLLSLSGKTLCVTAGSAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPL
GQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTA
DF
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgcttcaacaagttccagaaaacataaattttcctgctgaagaagagaaaatcttggag
ttttggactgaatttaattgttttcaggaatgcttaaagcaatcaaaacataaaccaaaa
tttaccttctatgatggtcctccttttgcaactggactgcctcactatggacatatactt
gcgggtacaattaaagatatagttacaagatatgctcaccagagtgggtttcatgttgac
agaagatttggatgggattgccatggcttacctgtggaatatgaaattgataagacactg
ggaatcagaggaccagaggatgtggccaaaatggggattacagagtataacaatcagtgc
cgagcaattgtgatgagatattctgctgagtggaagtctactgttagcagacttggccga
tggattgactttgacaatgactataaaactctgtatccacaattcatggaatcagtctgg
tgggtcttcaaacaactctatgataaaggccttgtttatagaggtgtgaaagtcatgccc
ttctctacggcatgtaacactccactttccaacttcgagtcacaccagaattataaggat
gttcaagatccttcagtatttgtaactttccctttggaagaagatgaaactgtatcttta
gttgcttggacaaccactccctggactctacctagtaaccttgctgtgtgtgttaatcca
gaaatgcaatatgtgaaaattaaagatgttgccagaggacgattactcattttaatggaa
gccagattgtcagccctctataaattggagagtgactatgagatccttgaaagatttcct
ggtgcctatcttaaaggcaagaagtacaggcccctgtttgactatttcctgaagtgtaaa
gagaatggcgctttcactgtgcttgttgacaactatgtgaaggaagaagaaggcacaggg
gttgtccaccaagctccttacttcggtgctgaggactatcgggtctgtatggactttaac
attattcggaaagactcactccctgtttgccctgtggatgcttcaggctgcttcacaacg
gaggtgacagatttcgcaggacagtatgtgaaggatgctgacaaaagtatcatcaggact
ttgaaggaacaaggccgacttctggttgccaccaccttcactcacagctaccctttttgc
tggagatcagacactcctctaatttacaaagcagtgcccagctggtttgtgcgagtggag
aacatggtggaccagctcctaaggaacaatgacctgtgctactgggtcccagagttggta
cgagaaaaacgatttggaaattggctgaaagatgcacgtgactggacaatttccagaaac
agatactggggcacccccatcccactgtgggtcagcgatgactttgaggaggtggtatgc
attgggtcagtggcggaacttgaagaactgtcaggagcaaagatctcagatctccacaga
gagagtgttgaccacctgaccattccttcacgctgtgggaagggatccttgcaccgcatc
tctgaagtgtttgactgttggtttgagagtggcagcatgccctatgctcaggttcattac
ccgtttgaaaacaagagggagtttgaggatgcttttcctgcagatttcattgccgagggc
atcgaccaaaccagaggatggttttataccctgctggtgctggccacggccctctttgga
caaccgcctttcaagaacgtaattgtgaatgggcttgtcctggcaagtgatggccaaaaa
atgagcaaacggaaaaagaattatccagatccagtttccatcatccagaagtatggtgct
gatgccctcagattatatctgattaactcccctgtggtgagagcagaaaacctccgcttt
aaagaagagggtgtgcgggacgtccttaaggatgtactgctcccatggtacaatgcctat
cgcttcttaatccagaacgttctgaggctccagaaggaggaagaaatagaatttctctac
aatgagaacacggttagagaaagccccaacattacagaccggtggatcctgtccttcatg
cagtctctcattggcttctttgagactgaaatggcagcttataggctttatactgtggtg
cctcgcctggtcaagtttgtagatattctgaccaattggtatgttagaatgaaccgcaga
agattaaagggtgaaaatgggatggaggattgtgtcatggccctagaaaccttgtttagt
gttctgctttctctttgcagacttatggctccctacacaccttttctcactgaattgatg
taccagaatctaaaggtgctgattgaccctgtttctgttcaggacaaggacacactcagc
attcactacctcatgctgccccgtgttcgagaagaattgattgacaagaaaacagagagt
gcagtatctcagatgcagtctgtgattgaacttggaagagtgatcagagaccgaaaaact
attcccataaagtatcctttgaaagaaattgtggttatccatcaagatccagaagctctt
aaagatatcaagtctttggagaagtatatcattgaggaactcaatgttcgaaaagttaca
ctgtctacagataaaaacaagtatggcattcggctaagggcagaaccagatcacatggtc
ctggggaagcgtctgaagggagcctttaaggcagtgatgacgtccatcaagcagttgagc
agtgaggagctggagcagttccagaagactgggaccattgttgtggaaggccatgaattg
cacgatgaagacatccgcctcatgtacacctttgatcaggccacaggtgggactgcgcaa
tttgaagcacactcagatgctcaggctttggtcctcttagatgtcactcctgaccagtca
atggtagatgaaggaatggctcgggaagtcatcaatcgcatacagaaacttcgcaaaaag
tgcaatctggttccaactgatgaaatcacagtgtactataaagcaaagtctgaaggaaca
tatctgaatagtgttattgaaagccacacagagttcatatttaccaccataaaggctccc
ttgaaaccatatccagtttctccatcggataaagtccttattcaagaaaaaacacagttg
aagggatctgaactggaaattacactcaccagaggatcttcccttcctggtcctgcttgt
gcatatgtcaatcttaacatttgtgcaaatggcagtgaacaaggtggagtattgctcctg
gaaaatccaaaaggtgacaataggttggaccttttaaagctgaagagtgttgtcactagc
atttttggtgtgaaaaatacagagctggctgtcttccatgatgaaacagaaatacaaaac
caaactgacttactgagtcttagtggaaaaacactttgtgtgactgcaggatcggctccc
tctctgatcaacagttctagtactcttctttgtcagtatatcaacctacagctcctgaat
gcaaagccacaagagtgtttaatggggacagtgggcactctcctgcttgaaaacccactt
gggcagaatggactcacccaccaaggtcttctgtatgaagcagccaaggtgtttggcctt
cggagcaggaagctaaagctgtttctgaatgagacccaaacgcaggaaattacagaagac
atccccgtgaagactttgaatatgaagactgtgtatgtttctgtgttaccaacaacagca
gacttctag

DBGET integrated database retrieval system