KEGG   Homo sapiens (human): 337879
Entry
337879            CDS       T01001                                 

Gene name
KRTAP8-1, KAP8.1
Definition
(RefSeq) keratin associated protein 8-1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KRTAP
Other DBs
NCBI-GeneID: 337879
NCBI-ProteinID: NP_787053
HGNC: 18935
Ensembl: ENSG00000183640
Vega: OTTHUMG00000057771
Pharos: Q8IUC2(Tdark)
UniProt: Q8IUC2
Position
21q22.11
AA seq 63 aa
MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPF
ALY
NT seq 192 nt   +upstreamnt  +downstreamnt
atgctctgcgacaacttccccggggctgtcttcccaggatgctactggggcagctatggc
tacccgctgggatatagcgttggctgtggctatggcagcacctactctccagtgggctat
ggcttcggctatggctacaacggctgtggggctttcggctacaggagatactcgccattt
gctctctactga

DBGET integrated database retrieval system