KEGG   Homo sapiens (human): 337985
Entry
337985            CDS       T01001                                 

Gene name
KRTAP20-3, KAP19D, KAP20.3, KRTAP19P4
Definition
(RefSeq) keratin associated protein 20-3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KRTAP
Other DBs
NCBI-GeneID: 337985
NCBI-ProteinID: NP_001121549
HGNC: 34001
Ensembl: ENSG00000206104
Vega: OTTHUMG00000057798
Pharos: Q3LI60(Tdark)
UniProt: Q3LI60
Position
21q22.11
AA seq 44 aa
MSYYGNYYGGLGYGYDCKYSYTSGFGAFRILDCGYRCGCGGVWI
NT seq 135 nt   +upstreamnt  +downstreamnt
atgagctactatggcaactactacggaggactgggctatggctatgactgtaaatatagt
tatacctctggctttggtgcctttagaatcctggactgtggctacagatgtggctgtggt
ggggtatggatttga

DBGET integrated database retrieval system