KEGG   Homo sapiens (human): 338Help
Entry
338               CDS       T01001                                 

Gene name
APOB, FLDB, LDLCQ4, apoB-100, apoB-48
Definition
(RefSeq) apolipoprotein B
  KO
K14462  apolipoprotein B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
hsa04979  Cholesterol metabolism
Network
N00332  Vesicular uptake of lipoproteins
N00333  Mutation-caused aberrant APOB to vesicular uptake of lipoproteins
N00334  Mutation-inactivated LDLR to vesicular uptake of lipoproteins
N00335  Mutation-inactivated LDLRAP1 to vesicular uptake of lipoproteins
Disease
H00155  Familial hypercholesterolemia
H01270  Familial hypobetalipoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    338 (APOB)
   04979 Cholesterol metabolism
    338 (APOB)
   04977 Vitamin digestion and absorption
    338 (APOB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    338 (APOB)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    338 (APOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   338 (APOB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   338 (APOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vitellogenin_N DUF1943 DUF1081 ApoB100_C KinB_sensor
Motif
Other DBs
NCBI-GeneID: 338
NCBI-ProteinID: NP_000375
OMIM: 107730
HGNC: 603
Ensembl: ENSG00000084674
Vega: OTTHUMG00000090785
Pharos: P04114(Tchem)
UniProt: P04114 Q7Z7Q0 Q59HB3
Position
2p24.1
AA seq 4563 aa AA seqDB search
MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES
SSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSE
EFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD
TVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS
SSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSD
EAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPE
PSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTG
DEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKD
QEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
FDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALY
WVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRIL
GEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPT
GAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENR
QSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATY
ELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVN
DESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAH
WSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKE
FNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPA
LHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTST
DHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHV
EKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTAS
LKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLN
SHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGA
SMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSN
DMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQ
GVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALW
GEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGT
WKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDAL
EMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIAL
DDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRV
NLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQH
LAGKLKQHIEAIDVRVLLDQLGTTISFERINDVLEHVKHFVINLIGDFEVAEKINAFRAK
VHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELP
QKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTR
DRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKAL
VEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIK
IPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYS
ILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKIN
PLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQ
LTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEG
THESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRF
PLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGE
ANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKN
KHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHD
ELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQS
DIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKN
MEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHK
LSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDD
IWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLD
IAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFS
IPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFA
LNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDL
NAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEE
DGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFS
KWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
LYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGT
YQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKH
KLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEM
KFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQY
IMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQV
EQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELT
IIL
NT seq 13692 nt NT seq  +upstreamnt  +downstreamnt
atggacccgccgaggcccgcgctgctggcgctgctggcgctgcctgcgctgctgctgctg
ctgctggcgggcgccagggccgaagaggaaatgctggaaaatgtcagcctggtctgtcca
aaagatgcgacccgattcaagcacctccggaagtacacatacaactatgaggctgagagt
tccagtggagtccctgggactgctgattcaagaagtgccaccaggatcaactgcaaggtt
gagctggaggttccccagctctgcagcttcatcctgaagaccagccagtgcaccctgaaa
gaggtgtatggcttcaaccctgagggcaaagccttgctgaagaaaaccaagaactctgag
gagtttgctgcagccatgtccaggtatgagctcaagctggccattccagaagggaagcag
gttttcctttacccggagaaagatgaacctacttacatcctgaacatcaagaggggcatc
atttctgccctcctggttcccccagagacagaagaagccaagcaagtgttgtttctggat
accgtgtatggaaactgctccactcactttaccgtcaagacgaggaagggcaatgtggca
acagaaatatccactgaaagagacctggggcagtgtgatcgcttcaagcccatccgcaca
ggcatcagcccacttgctctcatcaaaggcatgacccgccccttgtcaactctgatcagc
agcagccagtcctgtcagtacacactggacgctaagaggaagcatgtggcagaagccatc
tgcaaggagcaacacctcttcctgcctttctcctacaagaataagtatgggatggtagca
caagtgacacagactttgaaacttgaagacacaccaaagatcaacagccgcttctttggt
gaaggtactaagaagatgggcctcgcatttgagagcaccaaatccacatcacctccaaag
caggccgaagctgttttgaagactctccaggaactgaaaaaactaaccatctctgagcaa
aatatccagagagctaatctcttcaataagctggttactgagctgagaggcctcagtgat
gaagcagtcacatctctcttgccacagctgattgaggtgtccagccccatcactttacaa
gccttggttcagtgtggacagcctcagtgctccactcacatcctccagtggctgaaacgt
gtgcatgccaacccccttctgatagatgtggtcacctacctggtggccctgatccccgag
ccctcagcacagcagctgcgagagatcttcaacatggcgagggatcagcgcagccgagcc
accttgtatgcgctgagccacgcggtcaacaactatcataagacaaaccctacagggacc
caggagctgctggacattgctaattacctgatggaacagattcaagatgactgcactggg
gatgaagattacacctatttgattctgcgggtcattggaaatatgggccaaaccatggag
cagttaactccagaactcaagtcttcaatcctgaaatgtgtccaaagtacaaagccatca
ctgatgatccagaaagctgccatccaggctctgcggaaaatggagcctaaagacaaggac
caggaggttcttcttcagactttccttgatgatgcttctccgggagataagcgactggct
gcctatcttatgttgatgaggagtccttcacaggcagatattaacaaaattgtccaaatt
ctaccatgggaacagaatgagcaagtgaagaactttgtggcttcccatattgccaatatc
ttgaactcagaagaattggatatccaagatctgaaaaagttagtgaaagaagctctgaaa
gaatctcaacttccaactgtcatggacttcagaaaattctctcggaactatcaactctac
aaatctgtttctcttccatcacttgacccagcctcagccaaaatagaagggaatcttata
tttgatccaaataactaccttcctaaagaaagcatgctgaaaactaccctcactgccttt
ggatttgcttcagctgacctcatcgagattggcttggaaggaaaaggctttgagccaaca
ttggaagctctttttgggaagcaaggatttttcccagacagtgtcaacaaagctttgtac
tgggttaatggtcaagttcctgatggtgtctctaaggtcttagtggaccactttggctat
accaaagatgataaacatgagcaggatatggtaaatggaataatgctcagtgttgagaag
ctgattaaagatttgaaatccaaagaagtcccggaagccagagcctacctccgcatcttg
ggagaggagcttggttttgccagtctccatgacctccagctcctgggaaagctgcttctg
atgggtgcccgcactctgcaggggatcccccagatgattggagaggtcatcaggaagggc
tcaaagaatgacttttttcttcactacatcttcatggagaatgcctttgaactccccact
ggagctggattacagttgcaaatatcttcatctggagtcattgctcccggagccaaggct
ggagtaaaactggaagtagccaacatgcaggctgaactggtggcaaaaccctccgtgtct
gtggagtttgtgacaaatatgggcatcatcattccggacttcgctaggagtggggtccag
atgaacaccaacttcttccacgagtcgggtctggaggctcatgttgccctaaaagctggg
aagctgaagtttatcattccttccccaaagagaccagtcaagctgctcagtggaggcaac
acattacatttggtctctaccaccaaaacggaggtgatcccacctctcattgagaacagg
cagtcctggtcagtttgcaagcaagtctttcctggcctgaattactgcacctcaggcgct
tactccaacgccagctccacagactccgcctcctactatccgctgaccggggacaccaga
ttagagctggaactgaggcctacaggagagattgagcagtattctgtcagcgcaacctat
gagctccagagagaggacagagccttggtggataccctgaagtttgtaactcaagcagaa
ggtgcgaagcagactgaggctaccatgacattcaaatataatcggcagagtatgaccttg
tccagtgaagtccaaattccggattttgatgttgacctcggaacaatcctcagagttaat
gatgaatctactgagggcaaaacgtcttacagactcaccctggacattcagaacaagaaa
attactgaggtcgccctcatgggccacctaagttgtgacacaaaggaagaaagaaaaatc
aagggtgttatttccataccccgtttgcaagcagaagccagaagtgagatcctcgcccac
tggtcgcctgccaaactgcttctccaaatggactcatctgctacagcttatggctccaca
gtttccaagagggtggcatggcattatgatgaagagaagattgaatttgaatggaacaca
ggcaccaatgtagataccaaaaaaatgacttccaatttccctgtggatctctccgattat
cctaagagcttgcatatgtatgctaatagactcctggatcacagagtccctcaaacagac
atgactttccggcacgtgggttccaaattaatagttgcaatgagctcatggcttcagaag
gcatctgggagtcttccttatacccagactttgcaagaccacctcaatagcctgaaggag
ttcaacctccagaacatgggattgccagacttccacatcccagaaaacctcttcttaaaa
agcgatggccgggtcaaatataccttgaacaagaacagtttgaaaattgagattcctttg
ccttttggtggcaaatcctccagagatctaaagatgttagagactgttaggacaccagcc
ctccacttcaagtctgtgggattccatctgccatctcgagagttccaagtccctactttt
accattcccaagttgtatcaactgcaagtgcctctcctgggtgttctagacctctccacg
aatgtctacagcaacttgtacaactggtccgcctcctacagtggtggcaacaccagcaca
gaccatttcagccttcgggctcgttaccacatgaaggctgactctgtggttgacctgctt
tcctacaatgtgcaaggatctggagaaacaacatatgaccacaagaatacgttcacacta
tcatgtgatgggtctctacgccacaaatttctagattcgaatatcaaattcagtcatgta
gaaaaacttggaaacaacccagtctcaaaaggtttactaatattcgatgcatctagttcc
tggggaccacagatgtctgcttcagttcatttggactccaaaaagaaacagcatttgttt
gtcaaagaagtcaagattgatgggcagttcagagtctcttcgttctatgctaaaggcaca
tatggcctgtcttgtcagagggatcctaacactggccggctcaatggagagtccaacctg
aggtttaactcctcctacctccaaggcaccaaccagataacaggaagatatgaagatgga
accctctccctcacctccacctctgatctgcaaagtggcatcattaaaaatactgcttcc
ctaaagtatgagaactacgagctgactttaaaatctgacaccaatgggaagtataagaac
tttgccacttctaacaagatggatatgaccttctctaagcaaaatgcactgctgcgttct
gaatatcaggctgattacgagtcattgaggttcttcagcctgctttctggatcactaaat
tcccatggtcttgagttaaatgctgacatcttaggcactgacaaaattaatagtggtgct
cacaaggcgacactaaggattggccaagatggaatatctaccagtgcaacgaccaacttg
aagtgtagtctcctggtgctggagaatgagctgaatgcagagcttggcctctctggggca
tctatgaaattaacaacaaatggccgcttcagggaacacaatgcaaaattcagtctggat
gggaaagccgccctcacagagctatcactgggaagtgcttatcaggccatgattctgggt
gtcgacagcaaaaacattttcaacttcaaggtcagtcaagaaggacttaagctctcaaat
gacatgatgggctcatatgctgaaatgaaatttgaccacacaaacagtctgaacattgca
ggcttatcactggacttctcttcaaaacttgacaacatttacagctctgacaagttttat
aagcaaactgttaatttacagctacagccctattctctggtaactactttaaacagtgac
ctgaaatacaatgctctggatctcaccaacaatgggaaactacggctagaacccctgaag
ctgcatgtggctggtaacctaaaaggagcctaccaaaataatgaaataaaacacatctat
gccatctcttctgctgccttatcagcaagctataaagcagacactgttgctaaggttcag
ggtgtggagtttagccatcggctcaacacagacatcgctgggctggcttcagccattgac
atgagcacaaactataattcagactcactgcatttcagcaatgtcttccgttctgtaatg
gccccgtttaccatgaccatcgatgcacatacaaatggcaatgggaaactcgctctctgg
ggagaacatactgggcagctgtatagcaaattcctgttgaaagcagaacctctggcattt
actttctctcatgattacaaaggctccacaagtcatcatctcgtgtctaggaaaagcatc
agtgcagctcttgaacacaaagtcagtgccctgcttactccagctgagcagacaggcacc
tggaaactcaagacccaatttaacaacaatgaatacagccaggacttggatgcttacaac
actaaagataaaattggcgtggagcttactggacgaactctggctgacctaactctacta
gactccccaattaaagtgccacttttactcagtgagcccatcaatatcattgatgcttta
gagatgagagatgccgttgagaagccccaagaatttacaattgttgcttttgtaaagtat
gataaaaaccaagatgttcactccattaacctcccattttttgagaccttgcaagaatat
tttgagaggaatcgacaaaccattatagttgtactggaaaacgtacagagaaacctgaag
cacatcaatattgatcaatttgtaagaaaatacagagcagccctgggaaaactcccacag
caagctaatgattatctgaattcattcaattgggagagacaagtttcacatgccaaggag
aaactgactgctctcacaaaaaagtatagaattacagaaaatgatatacaaattgcatta
gatgatgccaaaatcaactttaatgaaaaactatctcaactgcagacatatatgatacaa
tttgatcagtatattaaagatagttatgatttacatgatttgaaaatagctattgctaat
attattgatgaaatcattgaaaaattaaaaagtcttgatgagcactatcatatccgtgta
aatttagtaaaaacaatccatgatctacatttgtttattgaaaatattgattttaacaaa
agtggaagtagtactgcatcctggattcaaaatgtggatactaagtaccaaatcagaatc
cagatacaagaaaaactgcagcagcttaagagacacatacagaatatagacatccagcac
ctagctggaaagttaaaacaacacattgaggctattgatgttagagtgcttttagatcaa
ttgggaactacaatttcatttgaaagaataaatgacgttcttgagcatgtcaaacacttt
gttataaatcttattggggattttgaagtagctgagaaaatcaatgccttcagagccaaa
gtccatgagttaatcgagaggtatgaagtagaccaacaaatccaggttttaatggataaa
ttagtagagttggcccaccaatacaagttgaaggagactattcagaagctaagcaatgtc
ctacaacaagttaagataaaagattactttgagaaattggttggatttattgatgatgct
gtcaagaagcttaatgaattatcttttaaaacattcattgaagatgttaacaaattcctt
gacatgttgataaagaaattaaagtcatttgattaccaccagtttgtagatgaaaccaat
gacaaaatccgtgaggtgactcagagactcaatggtgaaattcaggctctggaactacca
caaaaagctgaagcattaaaactgtttttagaggaaaccaaggccacagttgcagtgtat
ctggaaagcctacaggacaccaaaataaccttaatcatcaattggttacaggaggcttta
agttcagcatctttggctcacatgaaggccaaattccgagagaccctagaagatacacga
gaccgaatgtatcaaatggacattcagcaggaacttcaacgatacctgtctctggtaggc
caggtttatagcacacttgtcacctacatttctgattggtggactcttgctgctaagaac
cttactgactttgcagagcaatattctatccaagattgggctaaacgtatgaaagcattg
gtagagcaagggttcactgttcctgaaatcaagaccatccttgggaccatgcctgccttt
gaagtcagtcttcaggctcttcagaaagctaccttccagacacctgattttatagtcccc
ctaacagatttgaggattccatcagttcagataaacttcaaagacttaaaaaatataaaa
atcccatccaggttttccacaccagaatttaccatccttaacaccttccacattccttcc
tttacaattgactttgtagaaatgaaagtaaagatcatcagaaccattgaccagatgctg
aacagtgagctgcagtggcccgttccagatatatatctcagggatctgaaggtggaggac
attcctctagcgagaatcaccctgccagacttccgtttaccagaaatcgcaattccagaa
ttcataatcccaactctcaaccttaatgattttcaagttcctgaccttcacataccagaa
ttccagcttccccacatctcacacacaattgaagtacctacttttggcaagctatacagt
attctgaaaatccaatctcctcttttcacattagatgcaaatgctgacatagggaatgga
accacctcagcaaacgaagcaggtatcgcagcttccatcactgccaaaggagagtccaaa
ttagaagttctcaattttgattttcaagcaaatgcacaactctcaaaccctaagattaat
ccgctggctctgaaggagtcagtgaagttctccagcaagtacctgagaacggagcatggg
agtgaaatgctgttttttggaaatgctattgagggaaaatcaaacacagtggcaagttta
cacacagaaaaaaatacactggagcttagtaatggagtgattgtcaagataaacaatcag
cttaccctggatagcaacactaaatacttccacaaattgaacatccccaaactggacttc
tctagtcaggctgacctgcgcaacgagatcaagacactgttgaaagctggccacatagca
tggacttcttctggaaaagggtcatggaaatgggcctgccccagattctcagatgaggga
acacatgaatcacaaattagtttcaccatagaaggacccctcacttcctttggactgtcc
aataagatcaatagcaaacacctaagagtaaaccaaaacttggtttatgaatctggctcc
ctcaacttttctaaacttgaaattcaatcacaagtcgattcccagcatgtgggccacagt
gttctaactgctaaaggcatggcactgtttggagaagggaaggcagagtttactgggagg
catgatgctcatttaaatggaaaggttattggaactttgaaaaattctcttttcttttca
gcccagccatttgagatcacggcatccacaaacaatgaagggaatttgaaagttcgtttt
ccattaaggttaacagggaagatagacttcctgaataactatgcactgtttctgagtccc
agtgcccagcaagcaagttggcaagtaagtgctaggttcaatcagtataagtacaaccaa
aatttctctgctggaaacaacgagaacattatggaggcccatgtaggaataaatggagaa
gcaaatctggatttcttaaacattcctttaacaattcctgaaatgcgtctaccttacaca
ataatcacaactcctccactgaaagatttctctctatgggaaaaaacaggcttgaaggaa
ttcttgaaaacgacaaagcaatcatttgatttaagtgtaaaagctcagtataagaaaaac
aaacacaggcattccatcacaaatcctttggctgtgctttgtgagtttatcagtcagagc
atcaaatcctttgacaggcattttgaaaaaaacagaaacaatgcattagattttgtcacc
aaatcctataatgaaacaaaaattaagtttgataagtacaaagctgaaaaatctcacgac
gagctccccaggacctttcaaattcctggatacactgttccagttgtcaatgttgaagtg
tctccattcaccatagagatgtcggcattcggctatgtgttcccaaaagcagtcagcatg
cctagtttctccatcctaggttctgacgtccgtgtgccttcatacacattaatcctgcca
tcattagagctgccagtccttcatgtccctagaaatctcaagctttctcttccagatttc
aaggaattgtgtaccataagccatatttttattcctgccatgggcaatattacctatgat
ttctcctttaaatcaagtgtcatcacactgaataccaatgctgaactttttaaccagtca
gatattgttgctcatctcctttcttcatcttcatctgtcattgatgcactgcagtacaaa
ttagagggcaccacaagattgacaagaaaaaggggattgaagttagccacagctctgtct
ctgagcaacaaatttgtggagggtagtcataacagtactgtgagcttaaccacgaaaaat
atggaagtgtcagtggcaacaaccacaaaagcccaaattccaattttgagaatgaatttc
aagcaagaacttaatggaaataccaagtcaaaacctactgtctcttcctccatggaattt
aagtatgatttcaattcttcaatgctgtactctaccgctaaaggagcagttgaccacaag
cttagcttggaaagcctcacctcttacttttccattgagtcatctaccaaaggagatgtc
aagggttcggttctttctcgggaatattcaggaactattgctagtgaggccaacacttac
ttgaattccaagagcacacggtcttcagtgaagctgcagggcacttccaaaattgatgat
atctggaaccttgaagtaaaagaaaattttgctggagaagccacactccaacgcatatat
tccctctgggagcacagtacgaaaaaccacttacagctagagggcctctttttcaccaac
ggagaacatacaagcaaagccaccctggaactctctccatggcaaatgtcagctcttgtt
caggtccatgcaagtcagcccagttccttccatgatttccctgaccttggccaggaagtg
gccctgaatgctaacactaagaaccagaagatcagatggaaaaatgaagtccggattcat
tctgggtctttccagagccaggtcgagctttccaatgaccaagaaaaggcacaccttgac
attgcaggatccttagaaggacacctaaggttcctcaaaaatatcatcctaccagtctat
gacaagagcttatgggatttcctaaagctggatgtaaccaccagcattggtaggagacag
catcttcgtgtttcaactgcctttgtgtacaccaaaaaccccaatggctattcattctcc
atccctgtaaaagttttggctgataaattcattattcctgggctgaaactaaatgatcta
aattcagttcttgtcatgcctacgttccatgtcccatttacagatcttcaggttccatcg
tgcaaacttgacttcagagaaatacaaatctataagaagctgagaacttcatcatttgcc
ctcaacctaccaacactccccgaggtaaaattccctgaagttgatgtgttaacaaaatat
tctcaaccagaagactccttgattcccttttttgagataaccgtgcctgaatctcagtta
actgtgtcccagttcacgcttccaaaaagtgtttcagatggcattgctgctttggatcta
aatgcagtagccaacaagatcgcagactttgagttgcccaccatcatcgtgcctgagcag
accattgagattccctccattaagttctctgtacctgctggaattgtcattccttccttt
caagcactgactgcacgctttgaggtagactctcccgtgtataatgccacttggagtgcc
agtttgaaaaacaaagcagattatgttgaaacagtcctggattccacatgcagctcaacc
gtacagttcctagaatatgaactaaatgttttgggaacacacaaaatcgaagatggtacg
ttagcctctaagactaaaggaacatttgcacaccgtgacttcagtgcagaatatgaagaa
gatggcaaatatgaaggacttcaggaatgggaaggaaaagcgcacctcaatatcaaaagc
ccagcgttcaccgatctccatctgcgctaccagaaagacaagaaaggcatctccacctca
gcagcctccccagccgtaggcaccgtgggcatggatatggatgaagatgacgacttttct
aaatggaacttctactacagccctcagtcctctccagataaaaaactcaccatattcaaa
actgagttgagggtccgggaatctgatgaggaaactcagatcaaagttaattgggaagaa
gaggcagcttctggcttgctaacctctctgaaagacaacgtgcccaaggccacaggggtc
ctttatgattatgtcaacaagtaccactgggaacacacagggctcaccctgagagaagtg
tcttcaaagctgagaagaaatctgcagaacaatgctgagtgggtttatcaaggggccatt
aggcaaattgatgatatcgacgtgaggttccagaaagcagccagtggcaccactgggacc
taccaagagtggaaggacaaggcccagaatctgtaccaggaactgttgactcaggaaggc
caagccagtttccagggactcaaggataacgtgtttgatggcttggtacgagttactcaa
gaattccatatgaaagtcaagcatctgattgactcactcattgattttctgaacttcccc
agattccagtttccggggaaacctgggatatacactagggaggaactttgcactatgttc
ataagggaggtagggacggtactgtcccaggtatattcgaaagtccataatggttcagaa
atactgttttcctatttccaagacctagtgattacacttcctttcgagttaaggaaacat
aaactaatagatgtaatctcgatgtatagggaactgttgaaagatttatcaaaagaagcc
caagaggtatttaaagccattcagtctctcaagaccacagaggtgctacgtaatcttcag
gaccttttacaattcattttccaactaatagaagataacattaaacagctgaaagagatg
aaatttacttatcttattaattatatccaagatgagatcaacacaatcttcagtgattat
atcccatatgtttttaaattgttgaaagaaaacctatgccttaatcttcataagttcaat
gaatttattcaaaacgagcttcaggaagcttctcaagagttacagcagatccatcaatac
attatggcccttcgtgaagaatattttgatccaagtatagttggctggacagtgaaatat
tatgaacttgaagaaaagatagtcagtctgatcaagaacctgttagttgctcttaaggac
ttccattctgaatatattgtcagtgcctctaactttacttcccaactctcaagtcaagtt
gagcaatttctgcacagaaatattcaggaatatcttagcatccttaccgatccagatgga
aaagggaaagagaagattgcagagctttctgccactgctcaggaaataattaaaagccag
gccattgcgacgaagaaaataatttctgattaccaccagcagtttagatataaactgcaa
gatttttcagaccaactctctgattactatgaaaaatttattgctgaatccaaaagattg
attgacctgtccattcaaaactaccacacatttctgatatacatcacggagttactgaaa
aagctgcaatcaaccacagtcatgaacccctacatgaagcttgctccaggagaacttact
atcatcctctaa

DBGET integrated database retrieval system