KEGG   Homo sapiens (human): 3382
Entry
3382              CDS       T01001                                 

Gene name
ICA1, ICA69, ICAp69
Definition
(RefSeq) islet cell autoantigen 1
  KO
K19863  islet cell auto antigen 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3382 (ICA1)
SSDB
Motif
Pfam: Arfaptin ICA69 DUF2750
Other DBs
NCBI-GeneID: 3382
NCBI-ProteinID: NP_001129492
OMIM: 147625
HGNC: 5343
Ensembl: ENSG00000003147
Vega: OTTHUMG00000152008
Pharos: Q05084(Tbio)
UniProt: Q05084 A0A024RA29
Position
7p21.3
AA seq 483 aa
MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKL
ELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKAL
CFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQEL
DPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLH
FWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKINQQESTDAAVQEPS
QLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKSEEGACLGPVA
GTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQ
TGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHEL
LNA
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtcaggacacaaatgcagttatccctgggacttacaggatcgatatgctcaagataag
tcagttgtaaataagatgcaacagaaatattgggagacgaagcaggcctttattaaagcc
acagggaagaaggaagatgaacatgttgttgcctctgacgcggacctggatgccaagcta
gagctgtttcattcaattcagagaacctgtctggacttatcgaaagcaattgtactctat
caaaagaggatatgtttcttgtctcaagaagaaaacgaactgggaaaatttcttcgatcc
caaggtttccaagataaaaccagagcaggaaagatgatgcaagcgacaggaaaggccctc
tgcttttcttcccagcaaaggttggccttacgaaatcctttgtgtcgatttcaccaagaa
gtggagacttttcggcatcgggccatctcagatacttggctgacggtgaaccgcatggaa
cagtgcaggacggaatatagaggagcactattatggatgaaggacgtgtctcaggagctt
gatccagacctctacaagcaaatggagaagttcaggaaggtacaaacacaagtgcgcctt
gcaaaaaaaaactttgacaaattgaagatggatgtttgtcaaaaagtggatcttcttgga
gcgagcagatgcaatctcttgtctcacatgctagcaacataccagaccactctgcttcat
ttttgggagaaaacttctcacactatggcagccatccatgagagtttcaaaggttatcaa
ccatatgaatttactactttaaagagcttacaagaccctatgaaaaaattagttgagaaa
gaagagaagaagaaaatcaaccagcaggaaagtacagatgcagccgtgcaggagccgagc
caattaatttcattagaggaagaaaaccagcgcaaggaatcctctagttttaagactgaa
gatggaaaaagtattttatctgccttagacaaaggctctacacatactgcatgctcagga
cccatagatgaactattagacatgaaatctgaggaaggtgcttgcctgggaccagtggca
gggaccccggaacctgaaggtgctgacaaagatgacctgctgctgttgagtgagatcttc
aatgcttcctccttggaagagggcgagttcagcaaagagtgggccgctgtgtttggagac
ggccaagtgaaggagccagtgcccactatggccctgggagagccagaccccaaggcccag
acaggctcaggtttccttccttcgcagcttttagaccaaaatatgaaagacttacaggcc
tcgctacaagaacctgctaaggctgcctcagacctgactgcctggttcagcctcttcgct
gacctcgacccactctcaaatcctgatgctgttgggaaaaccgataaagaacacgaattg
ctcaatgcatga

DBGET integrated database retrieval system