KEGG   Homo sapiens (human): 3383Help
Entry
3383              CDS       T01001                                 

Gene name
ICAM1, BB2, CD54, P3.58
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05150  Staphylococcus aureus infection
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00185  KSHV MIR2 to cell surface molecule-endocytosis
N00210  KSHV MIR1/2 to host-cell-protein inhibition
Disease
H00083  Allograft rejection
Drug target
Alicaforsen sodium: D02811
Enlimomab: D04000
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3383 (ICAM1)
   04668 TNF signaling pathway
    3383 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3383 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3383 (ICAM1)
   04670 Leukocyte transendothelial migration
    3383 (ICAM1)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    3383 (ICAM1)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3383 (ICAM1)
   05416 Viral myocarditis
    3383 (ICAM1)
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    3383 (ICAM1)
  09167 Infectious diseases
   05150 Staphylococcus aureus infection
    3383 (ICAM1)
   05166 HTLV-I infection
    3383 (ICAM1)
   05164 Influenza A
    3383 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3383 (ICAM1)
   05169 Epstein-Barr virus infection
    3383 (ICAM1)
   05144 Malaria
    3383 (ICAM1)
   05143 African trypanosomiasis
    3383 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3383 (ICAM1)
   04090 CD Molecules [BR:hsa04090]
    3383 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3383 (ICAM1)
   04091 Lectins [BR:hsa04091]
    3383 (ICAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3383 (ICAM1)
CD molecules [BR:hsa04090]
 Proteins
  3383 (ICAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   3383 (ICAM1)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  3383 (ICAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig C2-set_2 Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 3383
NCBI-ProteinID: NP_000192
OMIM: 147840
HGNC: 5344
Ensembl: ENSG00000090339
Vega: OTTHUMG00000180403
Pharos: P05362(Tchem)
UniProt: P05362
Structure
PDB: 

Position
19p13.2
AA seq 532 aa AA seqDB search
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcagcccccggcccgcgctgcccgcactcctggtcctgctcggggctctg
ttcccaggacctggcaatgcccagacatctgtgtccccctcaaaagtcatcctgccccgg
ggaggctccgtgctggtgacatgcagcacctcctgtgaccagcccaagttgttgggcata
gagaccccgttgcctaaaaaggagttgctcctgcctgggaacaaccggaaggtgtatgaa
ctgagcaatgtgcaagaagatagccaaccaatgtgctattcaaactgccctgatgggcag
tcaacagctaaaaccttcctcaccgtgtactggactccagaacgggtggaactggcaccc
ctcccctcttggcagccagtgggcaagaaccttaccctacgctgccaggtggagggtggg
gcaccccgggccaacctcaccgtggtgctgctccgtggggagaaggagctgaaacgggag
ccagctgtgggggagcccgctgaggtcacgaccacggtgctggtgaggagagatcaccat
ggagccaatttctcgtgccgcactgaactggacctgcggccccaagggctggagctgttt
gagaacacctcggccccctaccagctccagacctttgtcctgccagcgactcccccacaa
cttgtcagcccccgggtcctagaggtggacacgcaggggaccgtggtctgttccctggac
gggctgttcccagtctcggaggcccaggtccacctggcactgggggaccagaggttgaac
cccacagtcacctatggcaacgactccttctcggccaaggcctcagtcagtgtgaccgca
gaggacgagggcacccagcggctgacgtgtgcagtaatactggggaaccagagccaggag
acactgcagacagtgaccatctacagctttccggcgcccaacgtgattctgacgaagcca
gaggtctcagaagggaccgaggtgacagtgaagtgtgaggcccaccctagagccaaggtg
acgctgaatggggttccagcccagccactgggcccgagggcccagctcctgctgaaggcc
accccagaggacaacgggcgcagcttctcctgctctgcaaccctggaggtggccggccag
cttatacacaagaaccagacccgggagcttcgtgtcctgtatggcccccgactggacgag
agggattgtccgggaaactggacgtggccagaaaattcccagcagactccaatgtgccag
gcttgggggaacccattgcccgagctcaagtgtctaaaggatggcactttcccactgccc
atcggggaatcagtgactgtcactcgagatcttgagggcacctacctctgtcgggccagg
agcactcaaggggaggtcacccgcaaggtgaccgtgaatgtgctctccccccggtatgag
attgtcatcatcactgtggtagcagccgcagtcataatgggcactgcaggcctcagcacg
tacctctataaccgccagcggaagatcaagaaatacagactacaacaggcccaaaaaggg
acccccatgaaaccgaacacacaagccacgcctccctga

DBGET integrated database retrieval system