KEGG   Homo sapiens (human): 338321Help
Entry
338321            CDS       T01001                                 

Gene name
NLRP9, CLR19.1, NALP9, NOD6, PAN12
Definition
(RefSeq) NLR family pyrin domain containing 9
  KO
K22663  NACHT, LRR and PYD domains-containing protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    338321 (NLRP9)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   338321 (NLRP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA AAA_25 AAA_22 RsgA_GTPase NB-ARC Mg_chelatase
Motif
Other DBs
NCBI-GeneID: 338321
NCBI-ProteinID: NP_789790
OMIM: 609663
HGNC: 22941
Ensembl: ENSG00000185792
Vega: OTTHUMG00000180920
Pharos: Q7RTR0(Tbio)
UniProt: Q7RTR0
Position
19q13.42
AA seq 991 aa AA seqDB search
MAESFFSDFGLLWYLKELRKEEFWKFKELLKQPLEKFELKPIPWAELKKASKEDVAKLLD
KHYPGKQAWEVTLNLFLQINRKDLWTKAQEEMRNKLNPYRKHMKETFQLIWEKETCLHVP
EHFYKETMKNEYKELNDAYTAAARRHTVVLEGPDGIGKTTLLRKVMLDWAEGNLWKDRFT
FVFFLNVCEMNGIAETSLLELLSRDWPESSEKIEDIFSQPERILFIMDGFEQLKFNLQLK
ADLSDDWRQRQPMPIILSSLLQKKMLPESSLLIALGKLAMQKHYFMLRHPKLIKLLGFSE
SEKKSYFSYFFGEKSKALKVFNFVRDNGPLFILCHNPFTCWLVCTCVKQRLERGEDLEIN
SQNTTYLYASFLTTVFKAGSQSFPPKVNRARLKSLCALAAEGIWTYTFVFSHGDLRRNGL
SESEGVMWVGMRLLQRRGDCFAFMHLCIQEFCAAMFYLLKRPKDDPNPAIGSITQLVRAS
VVQPQTLLTQVGIFMFGISTEEIVSMLETSFGFPLSKDLKQEITQCLESLSQCEADREAI
AFQELFIGLFETQEKEFVTKVMNFFEEVFIYIGNIEHLVIASFCLKHCQHLTTLRMCVEN
IFPDDSGCISDYNEKLVYWRELCSMFITNKNFQILDMENTSLDDPSLAILCKALAQPVCK
LRKLIFTSVYFGHDSELFKAVLHNPHLKLLSLYGTSLSQSDIRHLCETLKHPMCKIEELI
LGKCDISSEVCEDIASVLACNSKLKHLSLVENPLRDEGMTLLCEALKHSHCALERLMLMY
CCLTSVSCDSISEVLLCSKSLSLLDLGSNALEDNGVASLCAALKHPGCSIRELWLMGCFL
TSDSCKDIAAVLICNGKLKTLKLGHNEIGDTGVRQLCAALQHPHCKLECLGLQTCPITRA
CCDDIAAALIACKTLRSLNLDWIALDADAVVVLCEALSHPDCALQMLGLHKSGFDEETQK
ILMSVEEKIPHLTISHGPWIDEEYKIRGVLL
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcttttttttcggattttggcttgttgtggtatctgaaggagctcagaaag
gaagagttttggaaatttaaggagctcctcaaacaacctttggagaaatttgaactcaag
ccaatcccctgggctgagctgaagaaggcctccaaagaagatgtagcaaagctgctggac
aaacattacccaggaaagcaggcatgggaggtaacactgaacctgtttctacagatcaat
aggaaagatctctggacaaaggctcaggaagagatgagaaataagctaaacccatacaga
aagcatatgaaggaaacatttcaactcatatgggagaaggaaacctgtcttcacgtccct
gagcatttctacaaagaaaccatgaaaaatgagtataaagaattgaatgacgcatatact
gctgcggctagacgacacactgtggtcctggaaggtcctgatggaattggaaaaacaacc
cttttaagaaaagtgatgttggactgggcagagggaaacttatggaaggacaggttcaca
tttgtgtttttcctcaatgtctgtgaaatgaacggtatcgcagagaccagcttactggag
ctcctctctagggactggccggagtcttcagagaagatcgaagacattttttcccagcca
gagagaattctgttcatcatggatggctttgagcaactgaagtttaacttacaacttaag
gctgacttgagcgatgattggaggcagcggcagccaatgccaattatcctgagcagtttg
ttgcaaaaaaagatgcttccagaatcctctctccttattgcattaggaaaactggctatg
caaaaacactattttatgttgcggcatccaaaactcataaagctcttaggattcagtgaa
tctgaaaagaagtcgtatttctcctacttctttggtgagaagagcaaagccctgaaagtc
ttcaattttgtgagagataatgggccgctgtttatcttgtgccataatccctttacgtgc
tggttggtctgtacttgtgtgaaacagaggctagagaggggagaagaccttgaaataaac
tcccaaaacaccacctatttatatgcatcctttttaacaactgtattcaaagcaggaagt
cagagttttccacctaaggtgaacagagcccgactaaaaagcctgtgtgctttggctgca
gagggaatttggacatatacatttgtattttcccatggggatctccggaggaatgggtta
tctgagtctgagggcgtgatgtgggtgggtatgagactcctccaaaggagaggggactgt
tttgccttcatgcatctgtgtatccaagagttttgtgccgccatgttttatttgctcaaa
cgacccaaagacgatcctaacccggccattggaagcataacccagcttgtaagagcaagt
gtggttcagcctcaaaccctcttgacccaggtggggatattcatgtttggaatttcaaca
gaagaaatcgtcagcatgctggagacctcctttggttttccactgtcaaaagacctaaag
caggaaataacccaatgccttgaaagtttaagtcaatgtgaagctgatagggaagccata
gctttccaggaactattcattggtttgtttgaaactcaggaaaaagaatttgtaaccaaa
gtgatgaatttctttgaagaagttttcatttatattggtaacatagaacatttggtaata
gcttcattctgcctgaagcattgtcaacatttaacgacacttcgcatgtgtgtggagaat
atctttccagatgactcaggatgcatctcagattacaatgagaagctcgtctactggcgg
gagctttgctcaatgttcattaccaacaagaacttccagattttagacatggaaaatacc
agcctcgatgatccctccctggcgattctttgcaaagcgctggctcagcctgtttgtaaa
ctccgaaaactcatatttacttctgtgtactttggacatgattcagaattatttaaggca
gttcttcacaaccctcatctgaaacttctgagcctgtacggcactagcctctcccagtct
gacatcagacacctgtgtgagacgctgaaacatccaatgtgcaagatagaagagctgata
ctgggaaagtgtgacatctccagtgaagtttgtgaagacatcgcctccgtcctggcctgc
aacagcaagctgaaacacctctccttggtagaaaatcccttgagggacgaaggaatgacg
ttgctgtgtgaagccctgaagcactcacactgtgccctggagaggctgatgttgatgtac
tgctgtctcacctctgtctcctgtgactccatttccgaagtcctcttgtgcagtaagtcc
ctgtccctcctcgatctgggctcaaatgccctggaagataatggagtggcatctctgtgt
gcagcgctgaagcacccaggctgcagcatacgggagctgtggttgatgggctgtttcctt
acttccgattcctgtaaggacattgctgctgttcttatttgcaatgggaaactgaagacc
ctgaaacttgggcataatgaaataggagacactggtgtcagacagttatgtgcagctttg
cagcatcctcactgtaaattagagtgtctcgggctgcaaacgtgtccgatcacccgtgcc
tgctgcgacgacatcgccgcagcactcatcgcctgcaaaacactgaggagcctgaacctc
gactggattgccttggatgctgatgcagtggtggtgctgtgtgaggcattgagccacccg
gactgtgccctgcagatgctggggctgcacaaatctggctttgatgaagaaactcagaag
atcctgatgtctgtggaagaaaaaattccccatctgaccatttcacatggaccttggatt
gacgaggaatacaagatcaggggtgtgctcctctga

DBGET integrated database retrieval system