KEGG   Homo sapiens (human): 338322Help
Entry
338322            CDS       T01001                                 

Gene name
NLRP10, CLR11.1, NALP10, NOD8, PAN5, PYNOD
Definition
(RefSeq) NLR family pyrin domain containing 10
  KO
K22266  NACHT, LRR and PYD domains-containing protein 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    338322 (NLRP10)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    338322 (NLRP10)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    338322 (NLRP10)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   338322 (NLRP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN NOD2_WH AAA_25 NLRC4_HD2 AAA_16 NB-ARC AAA TsaE AAA_7 AAA_22 AAA_30 Zeta_toxin AAA_33 PhoH
Motif
Other DBs
NCBI-GeneID: 338322
NCBI-ProteinID: NP_789791
OMIM: 609662
HGNC: 21464
Ensembl: ENSG00000182261
Vega: OTTHUMG00000165673
Pharos: Q86W26(Tbio)
UniProt: Q86W26
Structure
PDB: 

Position
11p15.4
AA seq 655 aa AA seqDB search
MAMAKARKPREALLWALSDLEENDFKKLKFYLRDMTLSEGQPPLARGELEGLIPVDLAEL
LISKYGEKEAVKVVLKGLKVMNLLELVDQLSHICLHDYREVYREHVRCLEEWQEAGVNGR
YNQVLLVAKPSSESPESLACPFPEQELESVTVEALFDSGEKPSLAPSLVVLQGSAGTGKT
TLARKMVLDWATGTLYPGRFDYVFYVSCKEVVLLLESKLEQLLFWCCGDNQAPVTEILRQ
PERLLFILDGFDELQRPFEEKLKKRGLSPKESLLHLLIRRHTLPTCSLLITTRPLALRNL
EPLLKQARHVHILGFSEEERARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVV
CSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRVLRSLCSLAAEG
IQHQRFLFEEAELRKHNLDGPRLAAFLSSNDYQLGLAIKKFYSFRHISFQDFFHAMSYLV
KEDQSRLGKESRREVQRLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPC
LAQDLKHFKEQMESMKHNRTWDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQSQN
LFSVKSSLSHGPKEEQKCPSVHGQKEGKDNIAGTQKEASTGKGRGTEETPKNTYI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccaaggccagaaagccccgggaggcattgctctgggccttgagtgacctt
gaggagaacgatttcaagaagttaaagttctacttacgggatatgaccctgtctgagggc
cagcccccactggccagaggggagttggagggcctgattccggtggacctggcagaatta
ctgatttcaaagtatggagaaaaggaggctgtgaaagttgtcctcaagggcttgaaggtc
atgaacctgttggaacttgtggaccagctcagccatatttgtctgcatgattacagagaa
gtataccgagagcatgtgcgctgcctagaggaatggcaggaagcaggagtcaatggcaga
tacaaccaggtgctcctggtggccaagcccagctcagagagcccagaatcacttgcctgc
cccttcccggagcaggagctggagtctgtcacggtggaggctctatttgattcaggggaa
aagccctcactggccccatccttagttgtgctacaggggtcggctggcactggaaagaca
actctcgccagaaaaatggtgttggactgggccaccggtactctgtacccaggccggttt
gattatgtcttttatgtaagctgcaaagaagtggtcctgctgctggagagcaaactggag
cagctccttttctggtgctgcggggacaatcaagcccctgtcacagagattctgaggcag
ccagagcggctcctgttcatcctggatggctttgatgagctgcagaggccctttgaagaa
aagttgaagaagaggggtttgagtcccaaggagagcctgctgcaccttctaattaggaga
catacactccccacgtgctcccttctcatcaccacccggcccctggctttgaggaatctg
gagcccttgctgaaacaagcacgtcatgtccatatcctaggcttctctgaggaggagagg
gcgaggtacttcagctcctatttcacggatgagaagcaagctgaccgtgccttcgacatt
gtacagaaaaatgacattctctacaaagcgtgtcaggttccaggcatttgctgggtggtc
tgctcctggctgcaggggcagatggagagaggcaaagttgtcttagagacacctagaaac
agcactgacatcttcatggcttacgtctccacctttctgccgcccgatgatgatgggggc
tgctccgagctttcccggcacagggtcctgaggagtctgtgctccctagcagctgaaggg
attcagcaccagaggttcctatttgaagaagctgagctcaggaaacataatttagatggc
cccaggcttgccgctttcctgagtagtaacgactaccaattgggacttgccatcaagaag
ttctacagcttccgccacatcagcttccaggacttttttcatgccatgtcttacctggtg
aaagaggaccaaagccggctggggaaggagtcccgcagagaagtgcaaaggctgctggag
gtaaaggagcaggaagggaatgatgagatgaccctcactatgcagtttttactggacatc
tcgaaaaaagacagcttctcgaacttggagctcaagttctgcttcagaatttctccctgt
ttagcgcaggatctgaagcattttaaagaacagatggaatctatgaagcacaacaggacc
tgggatttggaattctccctgtatgaagctaaaataaagaatctggtaaaaggtattcag
atgaacaatgtatcattcaagataaaacattcaaatgaaaagaaatcacagagccagaat
ttattttctgtcaaaagcagcttgagtcatggacctaaggaggagcaaaaatgtccttct
gtccatggacagaaggagggcaaagataatatagcaggaacacaaaaggaagcttctact
ggaaaaggcagagggacagaggaaacaccaaaaaatacttacatataa

DBGET integrated database retrieval system