KEGG   Homo sapiens (human): 338339
Entry
338339            CDS       T01001                                 

Gene name
CLEC4D, CD368, CLEC-6, CLEC6, CLECSF8, Dectin-3, MCL, MPCL
Definition
(RefSeq) C-type lectin domain family 4 member D
  KO
K10058  C-type lectin domain family 4 member D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    338339 (CLEC4D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    338339 (CLEC4D)
   04090 CD molecules [BR:hsa04090]
    338339 (CLEC4D)
   04091 Lectins [BR:hsa04091]
    338339 (CLEC4D)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   338339 (CLEC4D)
CD molecules [BR:hsa04090]
 Proteins
  338339 (CLEC4D)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    338339 (CLEC4D)
SSDB
Motif
Pfam: Lectin_C ETRAMP
Other DBs
NCBI-GeneID: 338339
NCBI-ProteinID: NP_525126
OMIM: 609964
HGNC: 14554
Ensembl: ENSG00000166527
Vega: OTTHUMG00000168674
Pharos: Q8WXI8(Tbio)
UniProt: Q8WXI8
Structure
PDB: 
3WHD 2LS8

Position
12p13.31
AA seq 215 aa
MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEH
HAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLM
TISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGE
NCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggggctagaaaaacctcaaagtaaactggaaggaggcatgcatccccagctgatacct
tcggttattgctgtagttttcatcttacttctcagtgtctgttttattgcaagttgtttg
gtgactcatcacaacttttcacgctgtaagagaggcacaggagtgcacaagttagagcac
catgcaaagctcaaatgcatcaaagagaaatcagaactgaaaagtgctgaagggagcacc
tggaactgttgtcctattgactggagagccttccagtccaactgctattttcctcttact
gacaacaagacgtgggctgagagtgaaaggaactgttcagggatgggggcccatctgatg
accatcagcacggaagctgagcagaactttattattcagtttctggatagacggctttcc
tatttccttggacttagagatgagaatgccaaaggtcagtggcgttgggtggaccagacg
ccatttaacccacgcagagtattctggcataagaatgaacccgacaactctcagggagaa
aactgtgttgttcttgtttataaccaagataaatgggcctggaatgatgttccttgtaac
tttgaagcaagtaggatttgtaaaatacctggaacaacattgaactag

DBGET integrated database retrieval system