KEGG   Homo sapiens (human): 338382
Entry
338382            CDS       T01001                                 

Gene name
RAB7B, RAB7
Definition
(RefSeq) RAB7B, member RAS oncogene family
  KO
K07898  Ras-related protein Rab-7B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04145  Phagosome
hsa05132  Salmonella infection
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    338382 (RAB7B)
   04140 Autophagy - animal
    338382 (RAB7B)
   04137 Mitophagy - animal
    338382 (RAB7B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    338382 (RAB7B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    338382 (RAB7B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    338382 (RAB7B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    338382 (RAB7B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    338382 (RAB7B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    338382 (RAB7B)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 ATP_bind_1 cobW AAA_22 VirE Septin AAA_16 AAA_5 AAA PduV-EutP AAA_7
Other DBs
NCBI-GeneID: 338382
NCBI-ProteinID: NP_001157994
HGNC: 30513
Ensembl: ENSG00000276600
Vega: OTTHUMG00000189246
Pharos: Q96AH8(Tbio)
UniProt: Q96AH8
Position
1q32.1
AA seq 199 aa
MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaatccccggaagaaggtggacctgaaactcattatcgtcggagccattggtgtggga
aagacctccctccttcaccaatatgtgcacaagacgttttatgaggaataccagaccaca
ctgggggccagcatcctctccaagattatcatattgggtgacacaactttgaagttacag
atctgggacacgggcggtcaggagcggttccgctccatggtgtccacgttctacaagggc
tccgatggctgcatcctagcttttgatgtcaccgacctggagtcttttgaagccctggat
atctggcggggtgatgtcctggccaagattgtccccatggagcagtcctaccccatggtg
ttgttggggaacaagatcgatctggcagaccggaaggtaccccaggaagtagctcaaggc
tggtgtagagagaaagatattccttactttgaagtcagtgccaagaatgacatcaatgtg
gtgcaagcgtttgagatgctggccagtagggctctgtcgaggtaccagagcatcttagaa
aatcacctcacagaatccatcaagctctcgccagaccagtcaaggagcagatgctgctga

KEGG   Homo sapiens (human): 5868
Entry
5868              CDS       T01001                                 

Gene name
RAB5A, RAB5
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5868 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5868 (RAB5A)
   04145 Phagosome
    5868 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5868 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    5868 (RAB5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5868 (RAB5A)
   05152 Tuberculosis
    5868 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5868 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5868 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5868 (RAB5A)
   04031 GTP-binding proteins [BR:hsa04031]
    5868 (RAB5A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5868 (RAB5A)
 Endosome - Lysosome transport
    5868 (RAB5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5868 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   5868 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   5868 (RAB5A)
  Exosomal proteins of bladder cancer cells
   5868 (RAB5A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5868 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 5868
NCBI-ProteinID: NP_004153
OMIM: 179512
HGNC: 9783
Ensembl: ENSG00000144566
Vega: OTTHUMG00000129889
Pharos: P20339(Tbio)
UniProt: P20339 A0A024R2K1
Structure
PDB: 

Position
3p24.3
AA seq 215 aa
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctagtcgaggcgcaacaagacccaacgggccaaatacgggaaataaaatatgccag
ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg
caagcaagtcctaacattgtaatagctttatcgggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac
cttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

KEGG   Homo sapiens (human): 5869
Entry
5869              CDS       T01001                                 

Gene name
RAB5B
Definition
(RefSeq) RAB5B, member RAS oncogene family
  KO
K07888  Ras-related protein Rab-5B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5869 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5869 (RAB5B)
   04145 Phagosome
    5869 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5869 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5869 (RAB5B)
   05152 Tuberculosis
    5869 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5869 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5869 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5869 (RAB5B)
   04031 GTP-binding proteins [BR:hsa04031]
    5869 (RAB5B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5869 (RAB5B)
 Endosome - Lysosome transport
    5869 (RAB5B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5869 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   5869 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   5869 (RAB5B)
  Exosomal proteins of melanoma cells
   5869 (RAB5B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5869 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 5869
NCBI-ProteinID: NP_001238965
OMIM: 179514
HGNC: 9784
Ensembl: ENSG00000111540
Vega: OTTHUMG00000169682
Pharos: P61020(Tbio)
UniProt: P61020 A0A024RB09
Structure
PDB: 
2HEI

Position
12q13.2
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag
ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt
gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag
tccgtttgtctagatgacacaacagtgaagtttgagatctgggacacagctgggcaggag
cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac
gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaaa
cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg
gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat
ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Homo sapiens (human): 5878
Entry
5878              CDS       T01001                                 

Gene name
RAB5C, L1880, RAB5CL, RAB5L, RABL
Definition
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5878 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5878 (RAB5C)
   04145 Phagosome
    5878 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5878 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5878 (RAB5C)
   05152 Tuberculosis
    5878 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5878 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5878 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5878 (RAB5C)
   04031 GTP-binding proteins [BR:hsa04031]
    5878 (RAB5C)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5878 (RAB5C)
 Endosome - Lysosome transport
    5878 (RAB5C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5878 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   5878 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   5878 (RAB5C)
  Exosomal proteins of bladder cancer cells
   5878 (RAB5C)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5878 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 5878
NCBI-ProteinID: NP_004574
OMIM: 604037
HGNC: 9785
Ensembl: ENSG00000108774
Vega: OTTHUMG00000169703
Pharos: P51148(Tbio)
UniProt: P51148 A0A024R1U4
Structure
PDB: 
4KYI

Position
17q21.2
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt
caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc
tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc
atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

KEGG   Homo sapiens (human): 7879
Entry
7879              CDS       T01001                                 

Gene name
RAB7A, CMT2B, PRO2706, RAB7
Definition
(RefSeq) RAB7A, member RAS oncogene family
  KO
K07897  Ras-related protein Rab-7A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04145  Phagosome
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Disease
H00264  Charcot-Marie-Tooth disease
H00265  Hereditary sensory and autonomic neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7879 (RAB7A)
   04145 Phagosome
    7879 (RAB7A)
   04140 Autophagy - animal
    7879 (RAB7A)
   04137 Mitophagy - animal
    7879 (RAB7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    7879 (RAB7A)
   05152 Tuberculosis
    7879 (RAB7A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7879 (RAB7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7879 (RAB7A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7879 (RAB7A)
   04031 GTP-binding proteins [BR:hsa04031]
    7879 (RAB7A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    7879 (RAB7A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7879 (RAB7A)
  Exosomal proteins of other body fluids (saliva and urine)
   7879 (RAB7A)
  Exosomal proteins of colorectal cancer cells
   7879 (RAB7A)
  Exosomal proteins of bladder cancer cells
   7879 (RAB7A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    7879 (RAB7A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU cobW ATP_bind_1 PduV-EutP Septin AAA_22 NTPase_1 AAA_7 SRPRB AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NB-ARC NACHT TniB
Other DBs
NCBI-GeneID: 7879
NCBI-ProteinID: NP_004628
OMIM: 602298
HGNC: 9788
Ensembl: ENSG00000075785
Vega: OTTHUMG00000159812
Pharos: P51149(Tbio)
UniProt: P51149 A0A158RFU6
Structure
PDB: 
1T91 6IYB 3LAW 1YHN

Position
3q21.3
AA seq 207 aa
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg
aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca
ataggagctgactttctgaccaaggaggtgatggtggatgacaggctagtcacaatgcag
atatgggacacagcaggacaggaacggttccagtctctcggtgtggccttctacagaggt
gcagactgctgcgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat
agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttcccattt
gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag
gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc
aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg
gagctgtacaacgaatttcctgaacctatcaaactggacaagaatgaccgggccaaggcc
tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system