KEGG   Homo sapiens (human): 338398
Entry
338398            CDS       T01001                                 

Gene name
TAS2R60, T2R56, T2R60
Definition
(RefSeq) taste 2 receptor member 60
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    338398 (TAS2R60)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    338398 (TAS2R60)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    338398 (TAS2R60)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 338398
NCBI-ProteinID: NP_803186
OMIM: 613968
HGNC: 20639
Ensembl: ENSG00000185899
Vega: OTTHUMG00000154891
Pharos: P59551(Tbio)
UniProt: P59551
Position
7q35
AA seq 318 aa
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLV
SLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCV
KIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNV
TGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQ
AHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN
CRLRAVLKSRRSSRCGTP
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaatggagaccacatggttctaggatcttcggtgactgacaagaaggccatcatcttg
gttaccattttactccttttacgcctggtagcaatagcaggcaatggcttcatcactgct
gctctgggcgtggagtgggtgctacggagaatgttgttgccttgtgataagttattggtt
agcctaggggcctctcgcttctgtctgcagtcagtggtaatgggtaagaccatttatgtt
ttcttgcatccgatggccttcccatacaaccctgtactgcagtttctagctttccagtgg
gacttcctgaatgctgccaccttatggtcctctacctggctcagtgtcttctattgtgtg
aaaattgctaccttcacccaccctgtcttcttctggctaaagcacaagttgtctgggtgg
ctaccatggatgctcttcagctctgtagggctctccagcttcaccaccattctatttttc
ataggcaaccacagaatgtatcagaactatttaaggaaccatctacaaccttggaatgtc
actggcgatagcatacggagctactgtgagaaattctatctcttccctctaaaaatgatt
acttggacaatgcccactgctgtctttttcatttgcatgattttgctcatcacatctctg
ggaagacacaggaagaaggctctccttacaacctcaggattccgagagcccagtgtgcag
gcacacataaaggctctgctggctctcctctcttttgccatgctcttcatctcatatttc
ctgtcactggtgttcagtgctgcaggtatttttccacctctggactttaaattctgggtg
tgggagtcagtgatttatctgtgtgcagcagttcaccccatcattctgctcttcagcaac
tgcaggctgagagctgtgctgaagagtcgtcgttcctcaaggtgtgggacaccttga

DBGET integrated database retrieval system