KEGG   Homo sapiens (human): 338557Help
Entry
338557            CDS       T01001                                 

Gene name
FFAR4, BMIQ10, GPR120, GPR129, GT01, O3FAR1, PGR4
Definition
(RefSeq) free fatty acid receptor 4
  KO
K08425  free fatty acid receptor 4
Organism
hsa  Homo sapiens (human)
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    338557 (FFAR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    338557 (FFAR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 338557
NCBI-ProteinID: NP_859529
OMIM: 609044
HGNC: 19061
Ensembl: ENSG00000186188
Vega: OTTHUMG00000034409
Pharos: Q5NUL3(Tchem)
UniProt: Q5NUL3 B4DWG6
Position
10q23.33
AA seq 377 aa AA seqDB search
MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVC
ALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTL
SGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVV
PQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDA
RAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITI
LLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGA
ILTDTSVKRNDLSIISG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgaatgcgcgcgggcagcgggcgacgcgcccttgcgcagcctggagcaagcc
aaccgcacccgctttcccttcttctccgacgtcaagggcgaccaccggctggtgctggcc
gcggtggagacaaccgtgctggtgctcatctttgcagtgtcgctgctgggcaacgtgtgc
gccctggtgctggtggcgcgccgacgacgccgcggcgcgactgcctgcctggtactcaac
ctcttctgcgcggacctgctcttcatcagcgctatccctctggtgctggccgtgcgctgg
actgaggcctggctgctgggccccgttgcctgccacctgctcttctacgtgatgaccctg
agcggcagcgtcaccatcctcacgctggccgcggtcagcctggagcgcatggtgtgcatc
gtgcacctgcagcgcggcgtgcggggtcctgggcggcgggcgcgggcagtgctgctggcg
ctcatctggggctattcggcggtcgccgctctgcctctctgcgtcttcttccgagtcgtc
ccgcaacggctccccggcgccgaccaggaaatttcgatttgcacactgatttggcccacc
attcctggagagatctcgtgggatgtctcttttgttactttgaacttcttggtgccagga
ctggtcattgtgatcagttactccaaaattttacagacctcggaacacctcctggatgca
agagctgtcgtgactcacagtgagatcacaaaggcatcaaggaagaggctcacggtaagc
ctggcctactcggagagccaccagatccgcgtgtcccagcaggacttccggctcttccgc
accctcttcctcctcatggtctccttcttcatcatgtggagccccatcatcatcaccatc
ctcctcatcctgatccagaacttcaagcaagacctggtcatctggccgtccctcttcttc
tgggtggtggccttcacatttgctaattcagccctaaaccccatcctctacaacatgaca
ctgtgcaggaatgagtggaagaaaattttttgctgcttctggttcccagaaaagggagcc
attttaacagacacatctgtcaaaagaaatgacttgtcgattatttctggctaa

DBGET integrated database retrieval system