KEGG   Homo sapiens (human): 338567
Entry
338567            CDS       T01001                                 

Gene name
KCNK18, K2p18.1, MGR13, TRESK, TRESK-2, TRESK2, TRIK
Definition
(RefSeq) potassium two pore domain channel subfamily K member 18
  KO
K20007  potassium channel subfamily K member 18
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    338567 (KCNK18)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   338567 (KCNK18)
SSDB
Motif
Pfam: Ion_trans_2
Other DBs
NCBI-GeneID: 338567
NCBI-ProteinID: NP_862823
OMIM: 613655
HGNC: 19439
Ensembl: ENSG00000186795
Vega: OTTHUMG00000019120
Pharos: Q7Z418(Tclin)
UniProt: Q7Z418
Position
10q25.3
AA seq 384 aa
MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK
FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG
YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKW
CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL
QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI
LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN
RLIDIYKNVMLFFAKGKFYHLVKK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggaggtctcggggcacccccaggccaggagatgctgcccagaggccctgggaaagctc
ttccctggcctctgcttcctctgctttctggtgacctacgccctggtgggtgctgtggtc
ttctctgccattgaggacggccaggtcctggtggcagcagatgatggagagtttgagaag
ttcttggaggagctctgcagaatcttgaactgcagtgaaacagtggtggaagacagaaaa
caggatctccaggggcatctgcagaaggtgaagcctcagtggtttaacaggaccacacac
tggtccttcctgagctcgctctttttctgctgcacggtgttcagcaccgtgggctatggc
tacatctaccccgtcaccaggcttggcaagtacttgtgcatgctctatgctctctttggt
atccccctgatgttcctcgttctcacggacacaggcgacatcctggcaaccatcttatct
acatcttataatcggttccgaaaattccctttctttacccgccccctcctctccaagtgg
tgccccaaatctctcttcaagaaaaaaccggaccccaagcccgcagatgaagctgtccct
cagatcatcatcagtgctgaagagcttccaggccccaaacttggcacatgtccttcacgc
ccaagctgcagcatggagctgtttgagagatctcatgcgctagagaaacagaacacactg
caactgcccccacaagccatggagaggagtaactcgtgtcccgaactggtgttgggaaga
ctctcatactccatcatcagcaacctggatgaagttggacagcaggtggagaggttggac
atccccctccccatcattgcccttattgtttttgcctacatttcctgtgcagctgccatc
ctccccttctgggagacacagttggatttcgagaatgccttctatttctgctttgtcaca
ctcaccaccattgggtttggggatactgttttagaacaccctaacttcttcctgttcttc
tccatttatatcatcgttggaatggagattgtgttcattgctttcaagttggtgcaaaac
aggctgattgacatatacaaaaatgttatgctattctttgcaaaagggaagttttaccac
cttgttaaaaagtga

DBGET integrated database retrieval system