KEGG   Homo sapiens (human): 338596Help
Entry
338596            CDS       T01001                                 

Gene name
ST8SIA6, SIA8F, SIAT8-F, SIAT8F, ST8SIA-VI, ST8SiaVI
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6
  KO
K06615  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8F) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    338596 (ST8SIA6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     338596 (ST8SIA6)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   338596 (ST8SIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 338596
NCBI-ProteinID: NP_001004470
OMIM: 610139
HGNC: 23317
Ensembl: ENSG00000148488
Vega: OTTHUMG00000017748
Pharos: P61647(Tbio)
UniProt: P61647
Position
10p12.33
AA seq 398 aa AA seqDB search
MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATA
VPRATNSTYLNEKSLQLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAE
EYANFRAKLASCCDAVQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVD
YPYNQCAVVGNGGILNKSLCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSII
TLKYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFH
PKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSHHYY
DNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcggccggggggcgcactgctcgccctgctcgccagcctgctgctgctgctgctgctg
cgcctgctctggtgcccggcagacgcgcccggccgcgccaggattctggtggaggaaagc
agggaggccacccacggcacccccgcagcgctgaggacgctccggagcccggcgaccgcg
gtaccgcgcgccactaacagcacatatctgaatgagaagtcgctccaactgacggagaaa
tgcaaaaatctgcaatatggcattgagtctttctctaacaaaacgaaagggtattcagag
aacgactaccttcagattatcacagatatacagagttgtccatggaaacggcaagcagaa
gaatatgcaaattttagagccaaacttgcttcctgctgtgatgctgttcaaaactttgtt
gtttctcagaataacactccagttgggactaatatgagttacgaggtggaaagcaaaaaa
gaaatcccaattaagaagaacatttttcatatgtttccagtgtcccagccttttgtggac
tacccttataatcagtgtgcagtggtcggaaatgggggaattctgaataagtctctctgt
ggaactgaaatagataaatccgacttcgtttttaggtgtaacctacccccaaccacagga
gatgttagtaaagatgttggcagtaaaacaaatcttgtgactataaatccaagcatcata
actctgaaatatgggaacttaaaggaaaaaaaagccctatttctggaggacattgcaacc
tatggagatgcattttttcttctgccagcattttccttcagggccaacacgggtacctct
ttcaaagtatactacacgctcgaagagtctaaagcaagacaaaaggttctatttttccat
cccaagtacctgaaagatctggcccttttctggagaactaaaggtgtgactgcataccgc
ttgtccaccggcttgatgatcacaagtgttgcagtggaactgtgtaaaaatgtgaagctg
tatggattctggcccttctctaaaactgtagaagacatacctgtcagccatcactattat
gacaacaagctacctaaacatggtttccatcagatgcccaaagaatacagccagatcctc
caacttcacatgaaaggaatcctcaaactgcaatttagcaaatgtgaagtcgcctaa

DBGET integrated database retrieval system