KEGG   Homo sapiens (human): 3386Help
Entry
3386              CDS       T01001                                 

Gene name
ICAM4, CD242, LW
Definition
(RefSeq) intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
  KO
K06581  intercellular adhesion molecule 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3386 (ICAM4)
CD molecules [BR:hsa04090]
 Proteins
  3386 (ICAM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N
Motif
Other DBs
NCBI-GeneID: 3386
NCBI-ProteinID: NP_001535
OMIM: 614088
HGNC: 5347
Ensembl: ENSG00000105371
Vega: OTTHUMG00000180405
Pharos: Q14773(Tbio)
UniProt: Q14773
Position
19p13.2
AA seq 271 aa AA seqDB search
MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQ
PGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGK
TRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESL
ERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA
LASGSIAALVGILLTVGAAYLCKCLAMKSQA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggggtctctgttccctctgtcgctgctgttttttttggcggccgcctacccgggagtt
gggagcgcgctgggacgccggactaagcgggcgcaaagccccaagggtagccctctcgcg
ccctccgggacctcagtgcccttctgggtgcgcatgagcccggagttcgtggctgtgcag
ccggggaagtcagtgcagctcaattgcagcaacagctgtccccagccgcagaattccagc
ctccgcaccccgctgcggcaaggcaagacgctcagagggccgggttgggtgtcttaccag
ctgctcgacgtgagggcctggagctccctcgcgcactgcctcgtgacctgcgcaggaaaa
acacgctgggccacctccaggatcaccgcctacaaaccgccccacagcgtgattttggag
cctccggtcttaaagggcaggaaatacactttgcgctgccacgtgacgcaggtgttcccg
gtgggctacttggtggtgaccctgaggcatggaagccgggtcatctattccgaaagcctg
gagcgcttcaccggcctggatctggccaacgtgaccttgacctacgagtttgctgctgga
ccccgcgacttctggcagcccgtgatctgccacgcgcgcctcaatctcgacggcctggtg
gtccgcaacagctcggcacccattacactgatgctcgcttggagccccgcgcccacagct
ttggcctccggttccatcgctgcccttgtagggatcctcctcactgtgggcgctgcgtac
ctatgcaagtgcctagctatgaagtcccaggcgtaa

DBGET integrated database retrieval system