KEGG   Homo sapiens (human): 338645
Entry
338645            CDS       T01001                                 

Gene name
LUZP2, KFSP2566, PRO6246
Definition
(RefSeq) leucine zipper protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cep57_CLD_2 Type2_restr_D3 CmlA_N Leu_zip
Other DBs
NCBI-GeneID: 338645
NCBI-ProteinID: NP_001009909
OMIM: 608178
HGNC: 23206
Ensembl: ENSG00000187398
Vega: OTTHUMG00000166109
Pharos: Q86TE4(Tdark)
UniProt: Q86TE4
Position
11p14.3
AA seq 346 aa
MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQ
SLKNDEQSAKTDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVE
RKSKMIRDLQNENKSLKNKLLSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTD
LEQKLAVAKNELEKAALDRESQMKAMKETVQLCLTSVFRDQPPPPLSLITSNPTRMLLPP
RNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTTACDSQDEGRPCSMKHKESPP
SNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaattcagcccagcgcactacctgctgcctctcctgcctgcgctggtcctcagcacc
agacaggactatgaagagctagaaaagcagctgaaagaagtctttaaggagcgaagcacc
attcttcgtcagctgacaaagacatcaagagaacttgatggaattaaagtcaatcttcag
tccttaaaaaacgatgagcagtctgccaaaactgatgttcagaaacttctggaattagga
cagaaacaaagagaagaaatgaagtctcttcaggaggccctgcaaaatcagcttaaggag
acatcagagaaagcagaaaaacaccaggctactattaattttttaaagactgaagttgaa
agaaagagcaaaatgatccgagacctccagaatgagaataaaagcttgaaaaacaaactc
ttgtcaggaaacaagctctgtggcattcacgcagaagagtcaaaaaaaatccaagcccag
ctgaaggagcttcgttatgggaagaaggatttattatttaaggcgcagcagcttactgat
ctggaacaaaaattagctgtagccaaaaatgaactggagaaagcagctcttgacagggag
tcacagatgaaagcaatgaaagagactgtgcagctctgcttgacatctgttttccgtgat
cagcctcctccccctttgagtttaatcacatcaaatccaactcggatgttactcccaccc
aggaatattgcctctaagcttccagatgcagcggccaaaagcaagcctcaacaaagtgct
tctggaaacaatgagagctctcaagttgagtcaacaaaggaaggaaatccaagtaccact
gcctgtgactctcaagatgagggcagaccgtgttccatgaagcacaaagaaagtccccca
agtaatgccactgcagaaaccgagcctatcccacagaaattgcaaatgcctccttgctct
gaatgtgaggtgaaaaaagccccagaaaaaccattgaccagctttgaagggatggcagct
agagaagaaaaaatactgtaa

DBGET integrated database retrieval system