KEGG   Homo sapiens (human): 338657
Entry
338657            CDS       T01001                                 

Gene name
CENATAC, CCDC84, DLNB14
Definition
(RefSeq) centrosomal AT-AC splicing factor
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC84 zf-DBF
Other DBs
NCBI-GeneID: 338657
NCBI-ProteinID: NP_940891
HGNC: 30460
Ensembl: ENSG00000186166
Vega: OTTHUMG00000166348
Pharos: Q86UT8(Tdark)
UniProt: Q86UT8
Position
11q23.3
AA seq 332 aa
MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEH
ERCCWCLCCGCEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFL
VTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEE
GSSAPRSWKGMNSQVASSLQQPSNLDLPPAPELDWMETGPSLTFIGHQDIPGVGNIHSGA
TPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSF
GRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgccggcgcagcgctgccctctgtgccgccagaccttcttctgtggtcgcgggcac
gtttacagccgcaagcaccagcggcagctgaaggaggctttggagaggctcctgccccag
gtggaggcggcccgcaaggccatccgcgccgctcaggtggagcgctatgtgcccgaacac
gagcgatgctgctggtgcctgtgctgcggctgtgaggtgcgggaacacctgagccatgga
aacctgacggtgctgtacggggggctgctggagcatctggccagcccagagcacaagaaa
gcaaccaacaaattctggtgggagaacaaagctgaggtccagatgaaagagaagtttctg
gtcactccccaggattatgcgcgattcaagaaatccatggtgaaaggtttggattcctat
gaagaaaaggaggataaagtgatcaaggagatggcagctcagatccgtgaggtggagcag
agccgacaggaggtggttcggtctgtcttagagcctcaggcagtgccagacccagaagag
ggctcttcagcacctagaagctggaaagggatgaacagccaagtagcttccagcttacag
cagccctcaaatttggacctgccaccagctccagagcttgactggatggagacaggacca
tctctgacattcattggccatcaggatataccaggagttggtaacatccactcaggtgcc
acacctccctggatgatccaagatgaagaatacattgctgggaaccaagaaataggacca
tcctatgaagaatttcttaaagaaaaggaaaaacagaagttgaaaaaactccccccagac
cgagttggggccaactttgatcacagctccaggaccagtgcaggctggctgccctctttt
ggccgcgtctggaataatggacgccgctggcagtccagacatcaattcaaaactgaagct
gcagcaatgaagaagcagtcacatacagaaaaaagctaa

DBGET integrated database retrieval system