KEGG   Homo sapiens (human): 338692Help
Entry
338692            CDS       T01001                                 

Gene name
ANKRD13D
Definition
(RefSeq) ankyrin repeat domain 13D
  KO
K21437  ankyrin repeat domain-containing protein 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    338692 (ANKRD13D)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    338692 (ANKRD13D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPCR_chapero_1 UIM
Motif
Other DBs
NCBI-GeneID: 338692
NCBI-ProteinID: NP_001334830
OMIM: 615126
HGNC: 27880
Ensembl: ENSG00000172932
Vega: OTTHUMG00000162929
Pharos: Q6ZTN6(Tdark)
UniProt: Q6ZTN6 A0A024R5D5
Position
11q13.2
AA seq 518 aa AA seqDB search
MVQLVLQYRDYQRATQRLAGIPELLNKLRQAPDFYVEMKWEFTSWVPLVSKMCPSDVYRV
WKRGESLRVDTSLLGFEHMTWQRGRRSFIFKGQEAGALVMEVDHDRQVVHVETLGLTLQE
PETLLAAMRPSEEHVASRLTSPIVSTHLDTRNVAFERNKCGIWGWRSEKMETVSGYEAKV
YSATNVELVTRTRTEHLSDQDKSRSKAGKTPFQSFLGMAQQHSSHTGAPVQQAASPTNPT
AISPEEYFDPNFSLESRNIGRPIEMSSKVQRFKATLWLSEEHPLSLGDQVTPIIDLMAIS
NAHFAKLRDFITLRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPLSSVWVPAPSSAVA
ASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTV
WEALTNTRPGARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE
QLRLALELSSREQEERERRGQQEEEDLQRILQLSLTEH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagctggtgctccagtatcgggactaccagagggccacgcagaggctggcgggc
attccggaactgctcaacaaacttcgccaggcccccgatttctacgttgagatgaagtgg
gagttcaccagctgggtgccccttgtgtctaagatgtgcccaagcgatgtgtaccgcgtg
tggaagcggggtgagagcctgcgagtagacaccagtctcctgggcttcgagcacatgacc
tggcagcggggccggaggagcttcatcttcaagggccaggaggcaggagccctggtgatg
gaagtggaccatgaccggcaggtggtgcatgtggagacactggggctcactctgcaggag
cccgaaacactgctggccgccatgcggcccagcgaggagcatgtggccagtcgcctcacc
tctcctatcgtctccacccacctggacactcgtaatgtggcctttgagaggaacaaatgt
ggtatctggggctggcggtctgagaagatggaaactgttagcggctacgaggccaaggtg
tacagtgccaccaacgtggagctggtgacacgcacacgcacggagcacctctctgatcag
gacaagtcgaggagcaaagcggggaagactccattccagtccttcctggggatggcgcag
cagcattcctcccacaccggggcccccgtgcagcaggcagccagccccaccaaccccaca
gccatctcccctgaggagtacttcgaccccaacttcagcctggagtcacggaacattggc
cgccccatcgagatgtccagcaaagtacagaggttcaaggcaacactgtggctgagtgaa
gagcacccgctctccctgggtgaccaggtgacccccatcatcgacctaatggccatcagc
aacgctcactttgccaagctgcgcgacttcatcactctgcgccttccacctggcttcccc
gtcaaaattgagattccccttttccacgtgctcaatgcccgcatcaccttcagcaacctg
tgtggctgtgatgagcccctgagctccgtgtgggtgccggcccccagctctgctgttgcc
gcatcagggaaccctttcccgtgcgaggtggaccccaccgtgtttgaagtgcccaacggg
tacagcgtgctgggcatggagcgcaacgagcccctccgggacgaggacgatgacctcctg
cagttcgccatccagcagagcctgcttgaagcgggcactgaggcggagcaggtgaccgtc
tgggaagccctgaccaacacccggcccggtgcccgccctcctccccaggccacggtttat
gaggaacagcttcagctggagcgggccctccaggaaagcctgcagctgtccacagagccc
aggggcccaggatcccctcccaggacacccccagcccccggtccacccagctttgaagag
cagctgcgcctggccctggagttgtcttcacgggagcaggaggagcgggagcggcgcggg
cagcaggaggaggaggacttacagcggatcctgcagctgtcactcactgagcactga

DBGET integrated database retrieval system