KEGG   Homo sapiens (human): 338785
Entry
338785            CDS       T01001                                 

Gene name
KRT79, K6L, KRT6L
Definition
(RefSeq) keratin 79
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    338785 (KRT79)
   04147 Exosome [BR:hsa04147]
    338785 (KRT79)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     338785 (KRT79)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   338785 (KRT79)
  Exosomal proteins of other body fluids (saliva and urine)
   338785 (KRT79)
  Exosomal proteins of colorectal cancer cells
   338785 (KRT79)
  Exosomal proteins of bladder cancer cells
   338785 (KRT79)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 Spc7 Taxilin DHR10 CENP-F_leu_zip Muted Fib_alpha Tropomyosin_1 GAS AAA_13 DUF4061 SKA2 DUF745 Alanine_zipper ERM DUF948 Jnk-SapK_ap_N DUF724 UPF0242
Other DBs
NCBI-GeneID: 338785
NCBI-ProteinID: NP_787028
OMIM: 611160
HGNC: 28930
Ensembl: ENSG00000185640
Vega: OTTHUMG00000169878
Pharos: Q5XKE5(Tdark)
UniProt: Q5XKE5
Position
12q13.13
AA seq 535 aa
MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGSR
SLYNLGGHKSISVSVAGGALLGRALGGFGFGSRAFMGQGAGRQTFGPACPPGGIQEVTVN
QSLLTPLHVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQ
GQNLGVTRNNLEPLFEAYLGSMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINK
HTAAENEFVVLKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV
LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKN
EIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELALKDAQKKLGDLDVALHQAKE
DLTRLLRDYQELMNVKLALDVEIATYRKLLESEESRMSGECPSAVSISVTGNSTTVCGGG
AASFGGGISLGGSGGATKGGFSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaggtcctccgtctctcggcaaacatactccacaaaagggggcttcagctccaactct
gccagcggagggagtgggtcccaggcccgcaccagcttcagctcagtgacggtgtctcgg
agcagtggcagtggtggcggggcccactgtggccccggcacaggtggctttggcagccga
agcctctataacttggggggccacaagagtatctctgtcagtgtggccggaggggccttg
ttggggcgggctctggggggctttggctttggcagcagggcatttatgggacagggggct
ggcaggcagacgtttgggcctgcttgtcctcctggggggatccaggaggtcactgtcaac
cagagcctgctgacccccctccatgtggagattgaccccgagatccagcgagtgcgcact
caggagcgggagcagatcaagaccctcaacaacaagttcgcctccttcatcgacaaggtg
cggttcctggagcaacagaataaggtgctggagaccaagtgggcactgctgcaggagcag
ggccagaacttgggtgtcaccaggaacaacctggagcccctctttgaggcctacctgggt
agcatgcggagcacgctggacagacttcagagcgagcgggggaggctggactcagagctc
aggaacgtgcaggaccttgtggaggacttcaagaacaagtacgaggatgaaatcaacaag
cacactgctgcagagaacgagtttgtggtgctcaagaaggatgtggatgcagcatacatg
ggccggatggatctgcatggcaaagtgggcaccttgacccaggagattgacttcctgcag
caactctatgaaatggagctgagccaagtgcagacccacgtgtctaacaccaatgtggtg
ctgtccatggacaacaaccgcaacctggacctggacagcatcatcgccgaggtcaaggcc
cagtatgagctgattgcccagaggagccgggctgaggccgaggcctggtaccagaccaag
tatgaggagctgcaggtgactgctgggaagcatggggacaacctgcgggacaccaagaac
gagattgctgagctcacccgcactatccagaggctgcagggggaggctgatgcagccaag
aagcagtgtcagcagctgcagacggccattgcggaagcggagcagcgtggggagctggca
ctcaaggatgctcagaagaagcttggggatctggatgtggccctgcaccaggccaaggag
gacctgacacggctgctgcgtgactaccaggagctgatgaatgtcaagctggccctggac
gtggagattgccacctaccgcaagcttctggagagcgaggagagcaggatgtctggagaa
tgtcccagtgcagtcagcatttctgtgactggcaactccaccactgtgtgcggaggtggc
gcagccagctttggaggtggcatctccctgggtgggagtgggggggccaccaagggtgga
ttcagcacaaatgtgggctatagcaccgtcaagggagggccagtctctgcgggcacctcc
atcctgcggaagaccactacggtcaagacgtccagccagaggtattag

DBGET integrated database retrieval system