KEGG   Homo sapiens (human): 338872
Entry
338872            CDS       T01001                                 
Symbol
C1QTNF9, AQL1, C1QTNF9A, CTRP9
Name
(RefSeq) C1q and TNF related 9
  KO
K24213  complement C1q and tumor necrosis factor-related protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    338872 (C1QTNF9)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   338872 (C1QTNF9)
SSDB
Motif
Pfam: C1q Collagen BclA_C DUF1923
Other DBs
NCBI-GeneID: 338872
NCBI-ProteinID: NP_001290066
OMIM: 614285
HGNC: 28732
Ensembl: ENSG00000240654
Pharos: P0C862(Tdark)
UniProt: P0C862 A0A3B0J259
Position
13:24307166..24322531
AA seq 333 aa
MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGR
PGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGP
QGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGI
RGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGK
FTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDE
VWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaggatctggtggcttctgcttgccattgaaatctgcacagggaacataaactcacag
gacacctgcaggcaagggcaccctggaatccctgggaaccccggtcacaatggtctgcct
ggaagagatggacgagacggagcgaagggtgacaaaggcgatgcaggagaaccaggacgt
cctggcagcccggggaaggatgggacgagtggagagaagggagaacgaggagcagatgga
aaagttgaagcaaaaggcatcaaaggtgatcaaggctcaagaggatccccaggaaaacat
ggccccaaggggcttgcagggcccatgggagagaagggcctccgaggagagactgggcct
caggggcagaaggggaataagggtgacgtgggtcccactggtcctgaggggccaaggggc
aacattgggcctttgggcccaactggtttaccgggccccatgggccctattggaaagcct
ggtcccaaaggagaagctggacccacggggccccagggtgagccaggagtccggggaata
agaggctggaaaggagatcgaggagagaaagggaaaatcggtgagactctagtcttgcca
aaaagtgctttcactgtggggctcacggtgctgagcaagtttccttcttcagatatgccc
attaaatttgataagatcctgtataacgaattcaaccattatgatacagcagcggggaaa
ttcacgtgccacattgctggggtctattacttcacctaccacatcactgttttctccaga
aatgttcaggtgtctttggtcaaaaatggagtaaaaatactgcacaccaaagatgcttac
atgagctctgaggaccaggcctctggcggcattgtcctgcagctgaagctcggggatgag
gtgtggctgcaggtgacaggaggagagaggttcaatggcttgtttgctgatgaggacgat
gacacaactttcacagggttccttctgttcagcagcccgtga

DBGET integrated database retrieval system