KEGG   Homo sapiens (human): 338879Help
Entry
338879            CDS       T01001                                 

Gene name
RNASE10, RAH1, RNASE9
Definition
(RefSeq) ribonuclease A family member 10 (inactive)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 338879
NCBI-ProteinID: NP_001012993
HGNC: 19275
Ensembl: ENSG00000182545
Vega: OTTHUMG00000170986
Pharos: Q5GAN6(Tdark)
UniProt: Q5GAN6 W0UTC4
Position
14q11.2
AA seq 216 aa AA seqDB search
MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGD
GTQTTETLVLSNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECN
DMMAHKMKEPSQSCIAQYAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCEL
SQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaatctggtgcagatctttttcatgttgctgatgctgctgctgggcctgggg
atgggcctggggttgggacttcatatggctacagcagtcttggaggagagtgatcaaccg
ctcaatgaattttggtccagtgactcacaggacaaagctgaggccactgaggagggagac
ggcacccaaaccacagaaacgctggtgcttagcaacaaagaagtggtgcaacctggctgg
ccagaagatcccatcctcggtgaagatgaggttgggggtaacaagatgctcagagcctca
gctctctttcagagcaacaaagactatcttaggcttgaccagacagatagagaatgcaat
gatatgatggcacacaagatgaaggagcccagtcagagttgcatagcccagtatgcattc
atccatgaggatctaaacacagtcaaagctgtctgtaacagtcctgtcattgcctgtgag
ctcaaggggggaaaatgtcacaaaagctcccgaccttttgatttgacattgtgcgagctg
tcccaaccagaccaggtcactcctaactgcaattacctaacttctgttataaaaaagcac
attattataacctgtaatgacatgaagcgccagttaccaactggacaatga

DBGET integrated database retrieval system