KEGG   Homo sapiens (human): 339145
Entry
339145            CDS       T01001                                 
Symbol
CIBAR2, FAM92B
Name
(RefSeq) CBY1 interacting BAR domain containing 2
  KO
K23868  protein FAM92
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    339145 (CIBAR2)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   339145 (CIBAR2)
SSDB
Motif
Pfam: FAM92 IMD DUF4239
Other DBs
NCBI-GeneID: 339145
NCBI-ProteinID: NP_940893
OMIM: 617274
HGNC: 24781
Ensembl: ENSG00000153789
Pharos: Q6ZTR7(Tdark)
UniProt: Q6ZTR7 A0A1X7SC74
Position
16:complement(85098358..85112472)
AA seq 304 aa
MNIVFSRDSQVRVMENTVANTEKYFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANSE
NPELRATMRGFAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH
EIKQLEKLEKLRQKSPSDQQMISQAETRVQRAAVDSSRTTLQLEETVDGFQRQKLKDLQK
FFCDFVTIEMVFHAKAVEVYSSAFQTLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSP
PPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGGHLMLP
GHSL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaacatcgtcttctccagggacagccaggtgagggtgatggagaataccgtggccaac
accgagaagtactttgggcagttctgctcgctgctggccgcctacacgcgcaagacggcc
cggctgcgggacaaggcggaccagctggtcaagcagctcatcgactttgccaactccgag
aaccccgagctgcgggccaccatgaggggcttcgctgaggacctggccaaagtgcaggat
taccggcaggcccaggtcgagaggctggagaccaaggtggtcaaccccctgaagctctac
ggggcacagatcaagcagacacgggctgagatcaagaaattcaaacatgtccaaaatcat
gagatcaaacaactggaaaaactggagaaactgaggcagaagtcaccctcggatcagcaa
atgatctcccaggcagagaccagagtgcagagggccgctgtggactccagccgcaccacc
ctccagctggaggagactgtggatggcttccagaggcagaagctcaaggacctgcagaaa
tttttttgtgactttgtaactattgagatggttttccatgccaaagcggtggaggtgtat
tctagcgccttccagaccctggagaagtatgacctggagagggatctactggattttaga
gccaagatgcaaggagtttatgggcattatgacactcggctgcttgccaacaccagcccc
cctccatctgttcttcagtctctcgccagccagggaactctgcaggtccagctgagtagg
gcaaatgaagaccctgaacatcctcatgccaatcatggcaggtttagtctctgtgagtgg
gtggttaaggggcagccagcccactgtgtgtgtgggcagggtgggcatctcatgcttcca
ggacattctctctaa

DBGET integrated database retrieval system