KEGG   Homo sapiens (human): 339210
Entry
339210            CDS       T01001                                 
Symbol
C17orf67
Name
(RefSeq) chromosome 17 open reading frame 67
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4543 VMAP-M4
Other DBs
NCBI-GeneID: 339210
NCBI-ProteinID: NP_001078899
HGNC: 27900
Ensembl: ENSG00000214226
Pharos: Q0P5P2(Tdark)
UniProt: Q0P5P2
Position
17:complement(56791913..56833920)
AA seq 90 aa
MKTLPVLVLSLTLLTVFSETSPILTEKQAKQLLRSRRQDRPSKPGFPDEPMREYMHHLLA
LEHRAEEQFLEHWLNPHCKPHCDRNRIHPV
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaagacattgcctgtgctcgtgctgtctcttaccttactgactgtcttctcagagacc
tccccgattttgacagagaagcaggccaaacagctcctaagatctcggcgacaggataga
ccaagcaaacccggattccccgatgagccaatgcgggaatacatgcaccacctgctcgcc
ctggagcatcgcgctgaggagcagttcctggagcactggctgaaccctcactgcaaaccc
cactgtgacaggaacaggattcatcctgtgtaa

DBGET integrated database retrieval system