KEGG   Homo sapiens (human): 339231
Entry
339231            CDS       T01001                                 
Symbol
ARL16
Name
(RefSeq) ADP ribosylation factor like GTPase 16
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Arf RsgA_GTPase NACHT Roc AAA_22 AAA_16 AAA_5 AAA_18
Other DBs
NCBI-GeneID: 339231
NCBI-ProteinID: NP_001035114
OMIM: 619117
HGNC: 27902
Ensembl: ENSG00000214087
Pharos: Q0P5N6(Tdark)
UniProt: Q0P5N6
Position
17:complement(81681165..81683797)
AA seq 173 aa
MCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQRKITIRELG
GCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLP
CYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtgtctcctgctgggggccacgggcgtcgggaagacgctgctggtgaaacggctgcag
gaggtgagctcccgggatgggaaaggcgacctgggggagccgcccccgacacggcccacg
gtgggcaccaatcttactgacatcgtggcacagagaaagatcaccatccgggagcttggg
gggtgcatgggccccatctggtccagttactatggaaactgccgttctctcctgtttgtg
atggacgcctctgaccccacccagctctctgcatcctgtgtgcagctcttaggtctcctt
tctgcagaacaacttgcagaagcatcggtgctgatactcttcaataaaatcgacctaccc
tgttacatgtccacggaggagatgaagtcattaatcaggcttccagacatcattgcttgt
gccaagcagaacatcaccacggcagaaatcagcgcccgtgaaggcactggcttagcaggg
gtgctggcctggctccaggccacccacagagccaacgattga

DBGET integrated database retrieval system