KEGG   Homo sapiens (human): 339291
Entry
339291            CDS       T01001                                 

Gene name
LRRC30
Definition
(RefSeq) leucine rich repeat containing 30
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_9
Other DBs
NCBI-GeneID: 339291
NCBI-ProteinID: NP_001099051
HGNC: 30219
Ensembl: ENSG00000206422
Vega: OTTHUMG00000178479
Pharos: A6NM36(Tdark)
UniProt: A6NM36
Position
18p11.23
AA seq 301 aa
MGARQSRASSKDKGPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGM
TDIPDFLWGLSEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLK
VLFVNMNCLTEVPAELSLCRKLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPM
CVFSLKELIFLHVGSNRLENIAESIQHLASLQIFIAEGNNIHSFPRSLCLVTSLELLNLN
NNDIQTLPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLFGYLKDKKH
T
NT seq 906 nt   +upstreamnt  +downstreamnt
atgggggccaggcagtcaagggccagctccaaggataagggccccaagaggatgctgttc
acggggaggagacagaagttttctccgtgggacgatgccctgctctcgggaagggacccg
cggtccctgctgaagcggggcatgcaccacgtcagcttcagcctggtcacgagaggaatg
acagacatccccgactttctgtggggcttgtccgaggtccagaaactcaatctgtctcac
aaccagctccgggttctccctcccgaggtggggaaactgacccggatcgtggtcctgaac
ttgtgcgggaaccgcctgaagagcctgcccagagaagtgagcctcctacagtgcctcaag
gtcctgtttgtcaacatgaactgcctgacagaggtgccggccgagctgagcttgtgccga
aagctggaggtcctgagcttgtcgcacaactgcctgtcccagctccctgcatgcttcgcc
gacctctctagactgaggaagctaaacctcagcaacaacttcttcgcgcacatccccatg
tgtgtgttctccctgaaggaactgattttcttgcacgtgggctcgaatcgcctggaaaac
atcgctgagagcatccagcacctggccagcctgcagatcttcatcgcagagggcaacaac
atccactccttcccgaggtcgctttgcctggtcaccagcctggagctgctgaacctcaac
aacaatgacatccagaccctcccgagcgaactccacctgctgtgtagactggtgaggatc
gcctggaatcccatggacaaagggctccacatttcccacaaccctttatccaagcctctg
ccggagctggtggaggggggcctggagatgctcttcggctacctgaaggacaaaaaacac
acctga

DBGET integrated database retrieval system