KEGG   Homo sapiens (human): 339366Help
Entry
339366            CDS       T01001                                 

Gene name
ADAMTSL5, THSD6
Definition
(RefSeq) ADAMTS like 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 NTR TSP_1
Motif
Other DBs
NCBI-GeneID: 339366
NCBI-ProteinID: NP_998769
HGNC: 27912
Ensembl: ENSG00000185761
Vega: OTTHUMG00000180093
Pharos: Q6ZMM2(Tbio)
UniProt: Q6ZMM2 Q0VD77 X6R4H8
Position
19p13.3
AA seq 471 aa AA seqDB search
MDSAPLFPRPHLFQNLLLFLWALLNCGLGVSAQGPGEWTPWVSWTRCSSSCGRGVSVRSR
RCLRLPGEEPCWGDSHEYRLCQLPDCPPGAVPFRDLQCALYNGRPVLGTQKTYQWVPFHG
APNQCDLNCLAEGHAFYHSFGRVLDGTACSPGAQGVCVAGRCLSAGCDGLLGSGALEDRC
GRCGGANDSCLFVQRVFRDAGAFAGYWNVTLIPEGARHIRVEHRSRNHLALMGGDGRYVL
NGHWVVSPPGTYEAAGTHVVYTRDTGPQETLQAAGPTSHDLLLQVLLQEPNPGIEFEFWL
PRERYSPFQARVQALGWPLRQPQPRGVEPQPPAAPAVTPAQTPTLAPDPCPPCPDTRGRA
HRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPML
APHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCPG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggactcggcccctctgttccccaggccccacctcttccagaacctcctgctcttcctg
tgggccctgctgaactgtggtttgggggtcagtgctcagggtccgggcgagtggaccccg
tgggtgtcctggacccgctgctccagctcctgcgggcgtggcgtctctgtgcgcagccgg
cgctgcctccggcttcctggggaagaaccgtgctggggagactcccatgagtaccgcctc
tgccagttgccagactgccccccaggggctgtgcccttccgagacctacagtgtgccctg
tacaatggccgccctgtcctgggcacccagaagacctaccagtgggtgcccttccatggg
gcgcccaaccagtgcgacctcaactgcctggctgaggggcacgccttctaccacagcttc
ggccgcgtcctggacggcaccgcctgcagcccgggtgcccagggggtctgcgtggctggc
cgctgccttagcgccggctgtgatgggttgttgggctcgggtgccctcgaggaccgctgt
ggccgctgcggaggcgccaacgactcgtgccttttcgtgcagcgcgtgtttcgtgacgcc
ggtgccttcgctgggtactggaacgtgaccctgatccccgagggcgccagacacatccgc
gtggaacacaggagccgcaaccacctggcactgatggggggcgatgggcgctacgtgctt
aatgggcactgggtggtcagcccaccagggacctacgaggcggccggcacgcatgtggtc
tacacccgagacacagggccccaggagacattgcaagcagccgggcccacctcccatgac
ctgctcctacaggtcctcctgcaggagcccaaccctggcatcgagtttgagttctggctc
cctcgggagcgctacagccccttccaggctcgtgtgcaggccctgggctggcccctgagg
cagcctcagccccggggggtggagcctcagccccccgcagcccctgctgtcacccctgca
cagaccccaacgctggccccagacccctgcccaccctgccctgacacccgcggccgcgcc
caccgactactccactattgcggcagtgactttgtgttccaggcccgagtgctgggccac
caccaccaggcccaggagacccgctatgaggtgcgcatccagctcgtctacaagaaccgc
tcgccactgcgggcacgcgagtacgtgtgggcgccaggccactgcccctgcccgatgctg
gcaccccaccgggactacctgatggctgtccagcgtcttgtcagccccgacggcacacag
gaccagctgctgctgccccacgccggctacgcccggccctggagccctgcggaggacagc
cgcatacgcctgactgcccggcgctgtcctggctga

DBGET integrated database retrieval system