KEGG   Homo sapiens (human): 339416
Entry
339416            CDS       T01001                                 

Gene name
ANKRD45, CT117
Definition
(RefSeq) ankyrin repeat domain 45
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 339416
NCBI-ProteinID: NP_940895
OMIM: 618712
HGNC: 24786
Ensembl: ENSG00000183831
Vega: OTTHUMG00000040546
Pharos: Q5TZF3(Tdark)
UniProt: Q5TZF3
Position
1q25.1
AA seq 266 aa
MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPEN
PHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAW
GRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSL
AVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKM
TTPCQVKSAKSVTSHDQKRSQDDTSN
NT seq 801 nt   +upstreamnt  +downstreamnt
atggagtcagaaggacctccagagtcagagagttcagaatttttctcacagcaagaagag
gaaaatgaagaagaagaagcccaagaaccagaggaaacaggccctaagaaccccctttta
caacctgctctcacaggggatgtagagggtttgcagaagatatttgaggatcctgagaat
cctcatcatgaacaggccatgcagcttctcttagaagaagacatcgttgggagaaatttg
ttgtatgcagcttgcatggctgggcaaagtgacgtgattagagctttggcaaaatatggt
gtgaatctgaatgaaaaaaccaccagagggtacacactcttacattgtgctgcagcctgg
ggtcgtttggaaactttgaaagcactggtagaactggatgttgatatagaagctttgaac
ttccgggaagaaagggctcgagatgttgctgctagatattctcagactgagtgtgttgaa
ttcctggactgggcagatgcaaggctgactctgaaaaaatatattgcaaaagtctcttta
gctgttactgacacagaaaagggatcagggaaactccttaaggaagacaagaataccatc
ctcagtgcatgccgtgcaaaaaatgagtggttggaaacccatacagaagcttccattaat
gagctttttgagcagagacaacaactggaagatattgtgactcctatcttcacaaaaatg
actacaccatgtcaagtgaaaagtgccaaatctgtaacaagccatgaccagaagagaagt
caagatgatacctccaactga

DBGET integrated database retrieval system