KEGG   Homo sapiens (human): 339453Help
Entry
339453            CDS       T01001                                 

Gene name
TMEM240, C1orf70, SCA21
Definition
(RefSeq) transmembrane protein 240
Organism
hsa  Homo sapiens (human)
Disease
H00063  Spinocerebellar ataxia (SCA)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM240 Rad4
Motif
Other DBs
NCBI-GeneID: 339453
NCBI-ProteinID: NP_001108220
OMIM: 616101
HGNC: 25186
Ensembl: ENSG00000205090
Vega: OTTHUMG00000042193
Pharos: Q5SV17(Tbio)
UniProt: Q5SV17
Position
1p36.33
AA seq 173 aa AA seqDB search
MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHY
VIPYDGDQSVVDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRA
GRRYDGSWTWLPKLCSLRELGRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgagcgcgaacaccatgatcttcatgattctgggggcgtcggtcgtgatggcc
atcgcgtgcttgatggacatgaacgcgctgctggaccgattccacaactacatcctcccg
cacctgcggggcgaggaccgcgtctgccactgcaactgtggccggcaccatatccactac
gtgatcccgtacgacggggaccagtcggtggtggacgcctccgagaactactttgtgacg
gacagtgtgaccaagcaggagatcgacctcatgctggggctgctgctgggcttttgcatc
agctggttcctggtgtggatggacggcgtcctgcactgcgccgtgcgcgcctggagagcc
ggacggcgctacgatggctcgtggacctggctgcccaagctgtgcagcctgcgggagctg
ggccggcggccgcacaggcccttcgaggaggccgccgggaacatggtacacgtgaagcag
aaactctaccacaatggccaccccagcccgcggcacctgtga

DBGET integrated database retrieval system